SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019066 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019066
Domain Number 1 Region: 45-338
Classification Level Classification E-value
Superfamily L domain-like 1.11e-45
Family Ngr ectodomain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019066   Gene: ENSBTAG00000014340   Transcript: ENSBTAT00000019066
Sequence length 352
Comment pep:known chromosome:UMD3.1:5:20995380:21002991:-1 gene:ENSBTAG00000014340 transcript:ENSBTAT00000019066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTICFILWVVFVTDTVWTRSVRQVYEASDPEDWTMHDFDCPRECFCPPSFPTALYCEN
RGLKEIPAIPSRIWYLYLENNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQL
KKLLFLFLEDNELEEVPSPLPRSLEQLQLARNKVSRIPQGTFSNLENLTLLDLQHNKLLD
NAFQRDTFKGLKNLMQLNMAKNALRNMPPRLPANTMQLFLDNNSIEGIPENYFNVIPKVA
FLRLNHNKLSDAGLPSSGFNVSSILDLQLSHNQLTKVPKISAHLQHLYLDHNKIRNVNVS
VICPSTPTTLPVEDSFSYGPHLRYLRLDGNEIKPPIPMDLMTCFRLLQAVII
Download sequence
Identical sequences A0A140T890
ENSBTAP00000019066 9913.ENSBTAP00000019066 ENSBTAP00000019066 XP_010803060.1.76553 XP_015326371.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]