SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019137 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019137
Domain Number 1 Region: 124-506
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.77e-122
Family Myotubularin-like phosphatases 0.000000313
Further Details:      
 
Domain Number 2 Region: 14-115
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000861
Family GRAM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019137   Gene: ENSBTAG00000014390   Transcript: ENSBTAT00000019137
Sequence length 543
Comment pep:known chromosome:UMD3.1:2:122121403:122128496:1 gene:ENSBTAG00000014390 transcript:ENSBTAT00000019137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAEMIRTGQAQAELLRGPEEPPLRGTLCITGHHLLLSPGPQATPDLWLLLLRNVDSIE
KRVAGDSGTITLRCKDLRVLQLDIEGVEATLDIARSIEALSSLESVITSFPFFYRPKGLR
LGDAWHFHPPECYYKRVARETNAWRLSEANEDFSLCPSYPRAVIVPRAVDDSAVARSARF
RQGGRFPVLSYYHAPSGTVLLRAGQPLTGPQKRRCSEDEELLRAVLAGARPGARGFIVDT
RSPQAAKQARMTGGGTEAKAAYPGWKRLHRPLERGRPLQESFVRLVEACGDLEQSMDRWL
NRLESCRWLSHVKETLSTACLAAQSMEQEGACILVHGAEGTDSTLLITSLAQLILDPLSR
TMAGFQELIEREWVQAGHPFQLRCAHSAFSHARPKHEAPTFLLFLDCVWQLGRQFPLSLE
FGEGMLLALFDHAYASPFGTFLCNNEKERCLCEVRTRTHSLWSGLSQPKEQRKLRNPLYV
PNPLAIWPSAEPQSLRLWQGLFLRGTRPPEPSEVAWEKVWQIVTDQEKTEGSQPTDSASE
PGP
Download sequence
Identical sequences L8HY43 Q2KJ24
9913.ENSBTAP00000019137 ENSBTAP00000019137 NP_001039721.1.59421 NP_001039721.1.76553 XP_005906264.1.15283 XP_015315000.1.76553 ENSBTAP00000019137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]