SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019289 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000019289
Domain Number - Region: 60-90
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0549
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019289   Gene: ENSBTAG00000014511   Transcript: ENSBTAT00000019289
Sequence length 209
Comment pep:known chromosome:UMD3.1:16:52642160:52651239:1 gene:ENSBTAG00000014511 transcript:ENSBTAT00000019289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPHSCPLALARASGMDRCPLQAQLGQVTTTKSVTQGQQPECCVDAGNINATCPGTSLC
GPGCYGRPAEDGSVSCVQCRNGTHNSSECRGLAGRGAQFPVNKSAGMPGWQSVGGPQVAA
SLFLGTFLISSGLILSVAAFFYLKRASKLPKVFYGRNRAPALQPGEAAVMIPPPQSSVRK
PRYVRRERPLDRDVGPTTVSSVEARVSNV
Download sequence
Identical sequences Q58D09
NP_001026925.1.59421 NP_001026925.1.76553 ENSBTAP00000019289 ENSBTAP00000051080 9913.ENSBTAP00000019289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]