SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019305 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019305
Domain Number 1 Region: 591-645
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000883
Family BSTI 0.011
Further Details:      
 
Domain Number 2 Region: 827-886
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000335
Family VWC domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019305   Gene: ENSBTAG00000038262   Transcript: ENSBTAT00000019305
Sequence length 1015
Comment pep:novel chromosome:UMD3.1:29:51434553:51441943:-1 gene:ENSBTAG00000038262 transcript:ENSBTAT00000019305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTTSATPVHTSSTTSVPTTSSTSVQTNSTTSAPTTSSTSVQTSSTTSTPTTSVTPVHTSS
ATSAPTTSTISVQTSSATSAPTTSATPVHTSSTTSAPTTSATPVQTSSTTSVPTMSSTSV
HTSSATSAPTTSPTSVPTSETTPSPRSTVPCSCSVSGQLHPAAGSFIYQATDLSGHCYYA
FCNPDCHVVKGTAPTCPTSMPPPTPPATTSVSQQVCSNAVPPGTVTSPLLPFSGTQGAWE
GTLSGFQPESVKGETWPMPNCSEATCQGNGVITVSPRHCPRVQKPTCANGYPAVQVTDHD
GCCSHYQCPCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIVPVFGHFRVLVENYFCDA
EDGLSCPQSIIVEYHENRVMLTRKPVHGVMTNEIIFNGEVVRPGFQKGGIAVFQVGIKMY
VSIPKLGVQVMFSGLIFSVEVPFSKFANNTEGQCGTCTNDQKDECRLPGGTVVASCSDMS
GHWKVTYPGQPSCHGPPPTSGEPGTSPTPREPGTLPTPCPPSPICQLILSTPFELCHVLI
PPWPYYQGCTFDQCHMPGTDMVCTALELYAALCASLGVCVDWRGHTNSTCPFTCPVGMEY
WPCGPPIPSYCYTNNSASSLPITEGCFCPRGTMLYSSSKEVCVPDCNRPGVPRPQTVWPC
LECTCEGSTQTMSCQPQACPTAPACPESGQVPVPEAMQTGQCCPSTAAACDTRYCPEPEA
CPKGSRAIQTHREAACCPTYNCTGWTACSINGTLYQPGAVVSSSLCEKCWCELPGGALSD
TFLINCETQICSTSCPVGFKYQARARQCCGECVQVACVINTSNSSAHLFYPGESWSDPGD
HCVTHECEQHRDGLVVVTTKKACPPLNCPADKALPSEDGCCLFCPPHNNRSTCAVHHQLQ
VLRQQGCSSPGPVRLAYCRGNCGDTTSAFSPEANAVEHRCSCCRELRFSLRNVTLHCKDG
SSRALTYTEVEECGCEGLQCDSPGGLGLSAVALEPSPESGLRRRVRRAPRARPLP
Download sequence
Identical sequences G3X750
ENSBTAP00000019305 ENSBTAP00000019305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]