SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019433 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019433
Domain Number 1 Region: 43-274
Classification Level Classification E-value
Superfamily L domain-like 1.85e-35
Family Ngr ectodomain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019433   Gene: ENSBTAG00000014599   Transcript: ENSBTAT00000019433
Sequence length 857
Comment pep:known_by_projection chromosome:UMD3.1:6:69501920:69523156:-1 gene:ENSBTAG00000014599 transcript:ENSBTAT00000019433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNLCFRVITMVIGLYFTGTMTNPSRKSSILFNSKYQWNGYLTTNCSFAGKHEIPMDIPQ
MAPTVDDSSNFLRVLLQTHMKKEEWNIKHLDLSNNLISKITLSSLEHFHALETLNLSNNA
IHSVLLDLPSFKSSWVKRHRGSLRNRLPFLKLLTLQRNKLSNIPKGLWKLKSLQSLDLSF
NRISQIGLSDFHNCLQLENLHLKSNRIFRIHPEAFKDLKKLQMVDLSNNGLTAILPVVIM
ALELPHLEADLADNPWQCDYSLAVFQNVISESWRKRWNAICNESIGKEDAHWWTPTSRMS
RETHLPHADLKHMNTLIRSKAERAQEVRFSMLEKDTAGSDAGDRPRELPKRVRRAEDVRA
AGRKADSSQDLVLAVCLSVFITFFVAFCLGAFARPYVDRLWQQRCREKSPGSASGNEYSN
QAFYDEIEGAVNLQQPRMDLPQTFHHLNLYENQAPRTAVVPARTVAPSRREAGGRQDREQ
RRVSTGAGSGKDTVPPNHSAARRVLYGPPNAHDTQLTSAGWDHIYRNDPGEGNYDTVARQ
VSLSERSVGIPAVAAGIQTSPSSVRKDSDELGPPCPRETTMPLSQRPARTHTPSTGEERG
GVPPHFPSEFSKENGQSAQQQRLQGASAEGQPPAHYEAATLSDLGDPSPPGGPPGCCGDL
PVTPAYQEPAQKHTPDAQYEVDSDSDSEEGSLFTLSSTSSENWRNVAEEEAGGEQSWRAG
EPPGDQVSCERRDSVRPLESPKDNIAFQKTLRKCENQEDHFGKTVTSDPDSHLCQTHLES
ASNTNNYEDPLPRSSGSSSSSEEVPSMSIYNYISALQPSAVEWQYSLRDLEFANVDALPQ
TPPCSAKVPSDPDKCLS
Download sequence
Identical sequences E1BQ13
ENSBTAP00000019433 NP_001179375.1.59421 NP_001179375.1.76553 XP_005208015.1.76553 XP_005208016.1.76553 XP_010804431.1.76553 ENSBTAP00000019433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]