SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019457 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019457
Domain Number 1 Region: 19-206,352-558
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.45e-47
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0093
Further Details:      
 
Domain Number 2 Region: 684-937
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-46
Family YWTD domain 0.00000708
Further Details:      
 
Domain Number 3 Region: 1483-1668
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-28
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 1858-2031
Classification Level Classification E-value
Superfamily Fibronectin type III 9.85e-16
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 5 Region: 1119-1157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 6 Region: 1340-1377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 7 Region: 1246-1283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000115
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1076-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 9 Region: 1000-1037
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1291-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 11 Region: 1162-1195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 12 Region: 1394-1431
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 13 Region: 1434-1473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 1044-1077
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 1687-1836
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000204
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number 16 Region: 1199-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019457   Gene: ENSBTAG00000014611   Transcript: ENSBTAT00000019457
Sequence length 2138
Comment pep:known chromosome:UMD3.1:15:32584734:32755339:1 gene:ENSBTAG00000014611 transcript:ENSBTAT00000019457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRRRRSAALQQEPIQVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALAKPKSSDVY
VSYDYGRSFKRISEKLNFGEGNSSEAVIAQFYHSPADNKRYIFTDAYAQYLWTTFDFCNT
IQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSVSWGID
PYDKPNTIYVERHEPSGYSTVFRSTDFFQSRENLEVILEEVRDFQLRDKYMFATKVVHLF
GSPQPSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISE
AEGLKFSLSLENVLYYSPAGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLISGSMNEE
NMRSVITFDKGGTWEFLQAPAFTEYGEKINCELSQGCSLHLAQRLSQLLSLQLRRMPILS
KESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGM
ETNELKYSTNEGETWKTFVFSEEPVFVYGLLTEPGEKSTVFTIFGSNKENIHSWLILQVN
ATSALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCS
CTREDYECDFGFKMSEDLSLEVCVPDPEFSGNSFAPPVPCPVGSTYRRTRGYRKISGDTC
SGGDVEMRLEGELVPCPLAEENEFILYAMRKSIHRYDLASGATEQLPLTGLRSAVALDFD
YDRNCLYWSDLALDVIQRLCLNGSTGQEVIVNSGLETVEALAFEPLSQLLYWVDSGFKKI
EVGHPDGDFRLTIVNSSVLDRPRALVLVPQDGVMFWTDWGDLRPGIYRSNMDGSAAYRLV
SEDVKWPNGIAVDEQWIYWTDAYLDCIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWD
DWSQLSIFRASKYSGSDMAILASRLTGPMDLKIFYRGKTTGSNACASRPCSLLCLPKADG
SRSCRCPDGVSSSVLPSGDLMCECPPGYQQKNHKCVKEENTCLRNQYRCSNGKCINSIWW
CDFDNDCGDMSDERNCPTTVCDLDTQFRCHESGTCIPLSYKCDLEDDCGDNSDESHCEMH
QCRGDEYSCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRW
ACDGDMDCQDGSDEDPLNCEKKCNGFRCPNGTCIPSSKHCDGLHDCSDGSDEQHCEPLCT
RFMDFVCKNRQQCLFQSMVCDGIIQCRDGSDEDPEFAGCSRDPEFHKVCDEFSFQCQNGV
CISLIWKCDGMDDCGDDSDEANCENPTEAPTCSRYFQFQCENGHCIPNRWKCDRENDCGD
WSDEKDCGDSHILPSPTPGPSTCLPNYYRCSSGACVMDSWVCDGYRDCIDGSDEEACPSP
ANVTAASTPTQLGRCDRFEFECRQPKKCIPNWRRCDGHQDCQDGQDEANCPTHSTLTCTA
LEFQCQDGEACIMLSERCDGFLDCSDESDEHACSEELNVYKIQNLQWTADFSGDVTLTWI
RPKKMPSASCVYNVYYRVVGESIWNTLETHSNKTSTVLKVLKPDTTYQVKVQVQCLSKVH
STNDLVTLRTPEGLPDAPQSLQLSLHREVEGVIMGHWAPPVHTHGLIREYIVEYSRSGSK
MWASQRALSNFTEIKNLLVNTQYTVRVAAVTSRGIGNWSDSKSITTIKGQVIPTPDIRID
SYGENFLSFTLSMDTDIKVNGYVVNLFWSFDTHRQEKRTLNFRGIVSSQKVGNLTAHTPY
EISAWAKTDLGDSPLAFKRVTTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYAT
SFLDLYRNPKSLTTSQHNRTVLVSGDEQYLFLVRVVVPYQGPSSDYVVVRMIPDSRLPPR
HLHVVRMGKTSAVIKWESPYDSPDQDLLYAIAVKDLIRKSERSYKVKSRNSTVEYTLNKL
EPGGKYHIIVQLGNMSKDSSIKITTVSLLAPDALKIITENDHVLLFWKSLALKEKYFNES
RGYEIHMFDSVMNISAYLGNTTDNFFKISNLKLGHNYTFTVQARCLFGSQICGEPAVLLY
DELGSGGDASTIQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQNSFTAFANSH
YSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA
Download sequence
Identical sequences E1BPZ1
ENSBTAP00000019457 ENSBTAP00000019457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]