SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019496 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019496
Domain Number 1 Region: 148-219,266-532
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.43e-95
Family NadC C-terminal domain-like 0.0000129
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 5.21e-37
Family NadC N-terminal domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019496   Gene: ENSBTAG00000014642   Transcript: ENSBTAT00000019496
Sequence length 538
Comment pep:known_by_projection chromosome:UMD3.1:14:2327870:2331019:1 gene:ENSBTAG00000014642 transcript:ENSBTAT00000019496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEQDPEGRAAARPLLTDLYQATMALGYWRAGRAQDQAEFELFFRQCPFGGAFALAAGL
RDCVRFLRAFRLRDADVQFLASALPPDTDPAFFEHLRALDCSGVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLIATNAARLRLIAGPDKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDASSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGQGSQV
DLAASVEMWLERVCGHLGLGVQEPHRGERAAFVAYALAFPRAFQGLLDTYSVRRSGLPNF
LAVALALQELGYQAVGVRLDSGDLLQQAREIRGVFWTAAAQFGVPWLQSVPIAVSNNIDE
EELARLAQKGSEVNVIGIGTSVVTCPRQPSLGCVYKLVSVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGSDGSLLLDVLQLAEEPPPQADQELRVWPRGARESRTVRPAHVEPLLRLWVQQ
GQLCEPLPSLAESRAFAQQSLHRLSPAHRRLEQPALYQVALSEKLQALVDRLSARGAL
Download sequence
Identical sequences F1N3B0
ENSBTAP00000019496 XP_005215189.1.76553 9913.ENSBTAP00000019496 ENSBTAP00000019496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]