SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019636 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000019636
Domain Number - Region: 216-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000278
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 279-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000369
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 247-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000497
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 183-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000719
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 312-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00776
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019636   Gene: ENSBTAG00000014758   Transcript: ENSBTAT00000019636
Sequence length 381
Comment pep:known chromosome:UMD3.1:5:48917722:49009466:1 gene:ENSBTAG00000014758 transcript:ENSBTAT00000019636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKSAFPAGALWLWSILPCLLVLRAEVGQQPEESLYLWIDAHQARVLIGLEEDILIVSE
GKMAPFTHDFRRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQG
EAECPGGCRNGGFCNERRVCECPDGFYGPHCEKVLCSPRCMNGGLCVTPGFCICPPGFYG
VNCDKANCSATCFNGGTCFYPGKCICPPGLEGEQCETSKCPQPCRNGGKCIGKNKCKCSK
GYQGDLCSKPVCKPGCGTHGTCHEPNKCQCREGWHGRHCNKRYGASLLHTLRPAGAQLRQ
HTPSVKKAEERQDPPESNYIW
Download sequence
Identical sequences E1BNM8
ENSBTAP00000019636 9913.ENSBTAP00000019636 ENSBTAP00000042532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]