SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019848 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019848
Domain Number 1 Region: 144-258
Classification Level Classification E-value
Superfamily C-type lectin-like 8e-42
Family Link domain 0.0023
Further Details:      
 
Domain Number 2 Region: 3121-3278
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 3 Region: 253-354
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-28
Family Link domain 0.003
Further Details:      
 
Domain Number 4 Region: 29-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000317
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 5 Region: 3279-3337
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000973
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 3076-3116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000232
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019848   Gene: ENSBTAG00000014906   Transcript: ENSBTAT00000019848
Sequence length 3381
Comment pep:known_by_projection chromosome:UMD3.1:7:85666058:85782896:1 gene:ENSBTAG00000014906 transcript:ENSBTAT00000019848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINIKSILWMCSTLIAAHALQKVNMEKSPPVKGSLSGKVNLPCHFSTMPTLPPSYNTTS
EFLRIKWSKIELDKTGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEDVGDASLTMVK
LLASDAGRYRCDVMYGIEDTQDTVSLTVEGVVFHYRAATSRYTLNFEMAQKACVDIGAVI
ATPEQLHAAYEDGFEQCDAGWLSDQTVRYPIRVPREGCYGDMMGKEGVRTYGFRAPHETY
DVYCYVDHLDGDVFHITAPNKFTFEEAGEECKTQDARLATVGELQAAWRNGFDRCDYGWL
LDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKQNISEATTIE
LNMLAETVSPTLLEELQMGLDRMTPIVPLITELPVITTKVPPIGNIVNFEQKSTVQPLTS
THRSATESLPPDGSMKKPWDMDYYSPSASGPLGEPDVSEIKEEVPQSTTVVSHHAPDSWD
GVKEDLQIKDSVTQIEQIEVGPLVTSMEISKHIPSKEFTVTVTPFVSTTMTLESKTEKKA
ISTVSESVTTSHYGFTLREGDGEDRISTVRSGQSTSIFSQIPEVITVSKTSEDTTRGQLE
DVESVSASTIVSPDSDGSPMDHRQEKQTHGRITEGFLGQYVSTTPFPSQHHTEVELFPYS
GDKRLVEGTSTVISPTPRTGRERTETLRPAMRTVTYTNDEIQEKITKDSSIEKIEEEGFS
GMKFPTASPEQIHHTKYSVGMTKSFESPALMTTTKPGVTPTEATDVEEDFTTPSGLETDG
YQDTTEYEEGITTVHLIQSTLNVEVVTVSKWSLDEDNTTSKPLGSTEHVGSPKLPPALIT
TTGVSGKDKEMPSLTEDGRDEFTRIPGSTQRPLEEFTEEDTTDHEKFTVRFQPTTSIATT
EKSTLRDSITEERVPPFTSTEVRVTHATIEGSALDEGEDVDVSKPLSTVPQFAHPSDVEG
STFVNYSSTQEPTTYVDTSHTIPLPVIPKTEWGVLVPSIPSEGEVLGEPSQDIRVINQTH
FEASMYPETVRTTTEITQEATREDFLWKEQTPEKPVSPPSSTTDTAKETTPPLDEQESDG
SAYTVFEDRSVMGSDRVSVLVTTPIGKFEQHTSFPPGAVTKAKTDEVVTLTPTTGSKVTF
SPWPKQKYETEGTSPRGFVSPFSIGVTQLIEETTTEKREKTSLDYIDLGSGLFEKPKATE
LPEFSTVKATVPSDTAAFSSADRLHTPSASTEKPPLIDREPDEETTSDMVIIGESTSRVP
PTTLEDIVAKETETDIDREYFTTSSTSTTQPTRPPTVEGKEAFGPQAFSTPEPPAGTKFH
PDINVYIIEVRENKTGRMSDFSVSGHPIDSESKEDEPCSEETDPEHDLIAEILPELLGML
HSEEDEEDEECANATDVTTTPSVQYINGKHVVTTVPKDPEAAEARRGQFESVAPSQNFSD
SSESDSHQFIITHAGLPTAMQPNESKETTESLEITWRPEIYPETAEPFSSGEPDIFPTAS
IHEGEATEGPDSITEKNPELDHLVHEHAESVPLFPEESSGDAAIDQESQKIIFSGATEGT
FGEEAEKSSTTHTPSMVASSVSAPVSEDASFILTGTPQSDEPLSTVESWVEITPRHTVEF
SGSPSIPIPEGSGEAEEDKDKIFAMITDLSQRNTTDPRVTSDTSKIMITESLVDVPTTTV
YSISEQVSAVVPTKFVRETDTYEWVFSPPLEETTRKEEEKGTTGTASTVEVHSPTQRLDQ
FVSPSELESSSETPPDDSAAATRKSFTSQMTPTQSERETTSSTVVFKETEVLDNLAAQTT
DPSLSSQPGVLEVSPTVPGSPVSLFMEQGSGEAAVDPETTTVSSLSLNIEPEILAEEEAA
GTWSPNVETVFPFEPTEQVLSTAVDREVAETISQTSKENLVSEISGEPTHRAEIKGFSTD
FPLEEDFSGDFREYSTVSYPITKEEIVMMEGSGDAAFKDTQMLPSVTPTSDLSNHTADSE
EPGSTLVSTSAFPWEEFTASAEGSGEPLLSVSSSVDQVFPSAAGKASGTDSPFIDQRLGE
EGAINETDQRSTILPTAEAESTKASTEEGEVKENHTVSMDFPPTVEPDELWPRQEVNPVR
QGNGSEIVSEEKTQEQESFEPLQSSVAPEQTTFDSQTFPEPGLQTTGYFTLTTKKTYSTD
ERMEEEVISLADVSTPTLDSKGLVLYTTLPEVTEKSHFFLATASVTESVPAESVIAGSTI
KEEESIKPFPKVTSPIIKESDTDLIFSGLGSGEEVLPTLGSVNFTEIEQVLSTLYPLTSQ
VQSLEASILNDTSGDYEGMENVANEMRPLISKTDSIFEDGETASSTTLPEILSDARTEGP
FTAPLTFSTGPGQPQNQTHRRAEEIQTSRPQPLTDQVSSENSVTAETKETATPATDFLAR
TYDLEMAKGFVTSTPKPSDLFYEHSGEGSGELDAVGAEVHASGMTQATRQGSTTFVSDRS
LEKHPKVPSVEAVTVNGFPTVSMVLPLHPEQREGSPEATGTPASTASYEKATEGAADSFQ
DHFWGFKDSTLKPDKRKATESIIIDLDKEDKDLILTMTESTILEIIPELTSDKNTIIDID
HTKPIYEDILGMQTDLDPEVPSGPPDSSEESTQVQEKYEAAVNLSSTEENFEASGDILLA
NYTQATPESKAPEDRNPLDHTDFIFTTGIPILSSETELDVLLPTATSLPIPSKSATVNPE
SKTEAKTLEDIFESSTLSDGQAIADQSEVISTLGYLERTQNEDEAKKYVSPSFQPEFSSG
AEEALTDPTPYVSIGTTYLTAQSLTEAPDVMEGARLPDSIDTSTVSAFSELLSQTPSFPP
LSIHLGSGDSEHSEDLQPSALPSTDASTPPVSSGELANIEATFKPSSEEDFYITEPPSLP
PDTEPSEDESKPKLLEPTEASATELIAQEEIEIFQNSDNTTSVQVSGEAVKVFPSIETPE
AEAIVTAASETKLEGATLRPHSTSASVIHGVEAGVVPQPSPQTSERPTILSPLEISPETQ
AALIRGEDSTVAAPKQQVPTRMLDSNKQATLSTTELNTELATPSFPLLETSNETSFLIGI
NEESVEGTAVYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDRCELDFDECHSNP
CRNGATCIDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAER
ECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQP
DSFFSTGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRY
EINSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCLNPSAYQRTYSKKYFKNSSSAKD
NSINTSKHDHRWSRRWQESRR
Download sequence
Identical sequences F1MZ85
ENSBTAP00000019848 9913.ENSBTAP00000019848 ENSBTAP00000019848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]