SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019887 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019887
Domain Number 1 Region: 77-372
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-93
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019887   Gene: ENSBTAG00000014938   Transcript: ENSBTAT00000019887
Sequence length 375
Comment pep:novel chromosome:UMD3.1:28:42862876:42895314:-1 gene:ENSBTAG00000014938 transcript:ENSBTAT00000019887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFQNEVNSRKLKVFLRDFQHSDDFEDQFKDEAESENDGTLRKTSSFFLKQKSSSEDEELA
GPSHPALQAVSPRMEIVSEKELAQLALVRPLIFNTQEESTIRDYFKILTKKVSEDEITQE
FKALEVKNLPAVFHSGNELHNRDKNRYRDILPYDSTRVPLGNKDYINASYIKIANSREEY
YYIATQGPLPTTTNDFWQMVCENNSVIVMITKEKEGGVKCHHYWPISMKKPLELNSCRIF
LENYQILRYFIIRMFQVVKKSTGASHFVKHLQFTNWPDHGTPASAEGFIKYVRYVRKSHL
TGPVVVHCSAGVGRTGVFLCVDVVFCAIEKNFSFDIMNIVSQMREQRHGMVQTKEQYMFC
YKIVLEVLQKLWTVK
Download sequence
Identical sequences F1MYV6
ENSBTAP00000019887 ENSBTAP00000019887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]