SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019966 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019966
Domain Number 1 Region: 85-246,491-579,637-746
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.65e-50
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 
Domain Number 2 Region: 299-453,481-609
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-32
Family WD40-repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019966   Gene: ENSBTAG00000014996   Transcript: ENSBTAT00000019966
Sequence length 1498
Comment pep:known_by_projection chromosome:UMD3.1:18:46906321:46954817:1 gene:ENSBTAG00000014996 transcript:ENSBTAT00000019966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGPGGYARNDTVEKLPSVMAGVPARRAQSSPPPAPPLCLRRRTRLPAAPEDTVQNRV
SLEKVLGITAQNSSGLTCDPSTGHVAYLAGCVVVILNPKENKQQHILNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKSQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDILVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTEAKVTGTVPL
VGRSGILGELHDNVFCGVACGRGQMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLQYLTNLPKPHYLGVDVAQGLEPSFLFHRKAEATYP
DTVALTFDPMHQWLSCVYKDHSIYIWDVRDINQVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNMDSNPDSHWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGSENAMPVDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFTGNRDIQMISCG
ADKSIYFRSAQRASDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTMNG
KQKKCYKGSQGDDGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECVAKMFGHSEIVTG
MKFTYDCRHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHREQQQNTKDGKWSGHPRQE
IYASVPSEICSLSPGEQTEDELEEECESEELLKTPSKESLDPDPQCLLTNGKLPLWAKRL
LGDDDAADSTAFHAKRSYQPHGRWAERADQEPLKTILDARDLDCYFTPMKPESLEDSVLD
AMESQRLAGLLTESESPQEDGCGHPSLSPPQQGSPEASELITCPLETEVTVTGMDSEYCA
EEVVEACGDQQGDPFLPVPSIGSKDRSPPEDSGESEADLECSFTTIHSSPPQPDTEPQFD
TMPPIPGCPGTAGELPRPEVPDISNSSLPQTPEQEKFLRHHFETLTDAQPEGSLRDLKAP
ETEDDFFNPRLSISAQFLSRLQKTSRFPHAFPSRLPQHLVKSSEVRLTDLRGEPPTVGAG
STSPVRTNVVPGGKAEETLEVWSPLSPCLTGLVPCIPSSSALPTDKKPPAPTALPAAGLA
QVLHTPTTCSHMEATASSHAKMSRSISLEELASLSQELQAVTTTVTHSSDSEGREPALPS
RGNHEARASLKLSLSSICDRLLLPEPVDTERDVTVTTDGFPAHSPADGIASRLHKSAFLP
RFLAPVRLDTPVLPNSPPLPEARPRVLGSIASLREPTPEVPSPVQDCPGHWEDPRAPTSF
LPPDPLELSNVGTIVHRLQAAFQEALDLYHLMVSSDEVNAEQRQARTELASTFLWIHSQL
EASDWLVGMDVATAQAPPSPGAPSPPTLCPLASPDLRALLEHYSELLVQAVRRKARGD
Download sequence
Identical sequences E1BK25
ENSBTAP00000019966 ENSBTAP00000019966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]