SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019979 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019979
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.88e-24
Family Ribosomal L11/L12e N-terminal domain 0.0004
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.62e-18
Family Ribosomal protein L11, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019979   Gene: ENSBTAG00000015006   Transcript: ENSBTAT00000019979
Sequence length 192
Comment pep:known chromosome:UMD3.1:29:45127205:45130554:-1 gene:ENSBTAG00000015006 transcript:ENSBTAT00000019979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRALRKPEAEGVIRTILRAGQAMPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARNTGKEVAGLVTLKHVYEI
ARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQKE
ADLAAQAEAAKK
Download sequence
Identical sequences Q2YDI0
ENSBTAP00000019979 9913.ENSBTAP00000019979 ENSBTAP00000019979 NP_001014932.1.59421 NP_001014932.1.76553 XP_006044433.1.26621 XP_010836058.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]