SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000019994 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000019994
Domain Number 1 Region: 565-744
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-40
Family SPRY domain 0.00073
Further Details:      
 
Domain Number 2 Region: 370-562
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-23
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000019994   Gene: ENSBTAG00000015018   Transcript: ENSBTAT00000019994
Sequence length 750
Comment pep:known_by_projection chromosome:UMD3.1:21:23501906:23537791:-1 gene:ENSBTAG00000015018 transcript:ENSBTAT00000019994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGAGEAPGLGRSAASKDFRFYHMDLYDSQDRLQIFPEESTRMRREGVQAEMTHEPMRG
GVKVKAPRDLGEEVDELVHLYGLEDDHELGDEFIEENTPRIEVSEYPSYMMMGSEQRDWR
PTGEAAQGEDLGFMGWGSAGQCQDLREAYRYSHGRASEEYECYVIPEEEDEEEAADVFCV
TCKTPIRASEKDQDEHKQHEVTPLSKALESAKDEIHKNMYKLEKQIIEMENFASHLEEVF
ITVEENFGRQEQNFESHYNEILETLAQKYEEKIQALGEKKKEKLEALYGQLVNCGENLDT
CKELMETIEEMCHEEKVDFIKDAVAMADRLGKFLKTKTDEEISAQPDFEDQTLDFSDVEE
LMGSINTIPAPSAPVINPQAPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDGSPGKEQ
TEVTMTIKETYCSVTNLLPNTQYEFWVTAQNRAGLSPTSERAVYMTAPCPPIIKSKEIRS
CEEAALISWESGNLNPVDSYTVELTQAETPGASGVTESVVGIPTCECLVQLQPRQNYTIY
VRALNVGGPSARSEPATVHTTGSYFSLDEHTCHPRLTVSEDGLTVVRSERRGPAKEPVPS
DAQFTRTRCAAVMGNLIPVRGRHYWEVEVDECLDYTVGVAFEDVPRQEDLGANRLSWCMR
HAFASSRHKYEFLHNKMTPDIRITVPPKKIGILLDYENAKLSFFNVDISQHLYTFSCQLH
QFVHPCFSLEKPGCLKIYNGISMPKHVTFY
Download sequence
Identical sequences E1BJZ1
ENSBTAP00000019994 ENSBTAP00000019994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]