SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020053 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020053
Domain Number 1 Region: 587-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-81
Family Eukaryotic proteases 0.0000507
Further Details:      
 
Domain Number 2 Region: 88-217
Classification Level Classification E-value
Superfamily SEA domain 9.42e-23
Family SEA domain 0.0069
Further Details:      
 
Domain Number 3 Region: 232-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000379
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 4 Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000072
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 355-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000236
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000812
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000916
Family LDL receptor-like module 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000020053
Domain Number - Region: 61-98
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0981
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020053   Gene: ENSBTAG00000015065   Transcript: ENSBTAT00000020053
Sequence length 829
Comment pep:known_by_projection chromosome:UMD3.1:1:57213904:57268918:1 gene:ENSBTAG00000015065 transcript:ENSBTAT00000020053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENSHISSKPVDVNISNISVQVVNTPGKLPGRRPPRKPIARAKPKKQLKKKAPFWNVQ
NKIILFTVFLFILAVIAWTLLWLYIGKTESRDAFYFAGMFRITNIEFLPEYRQKESREFL
SVARTVQQVINLVYTTSAFSKFYKQSVVADVSSNNKGGLLVHFWLVFVMPHAKGHIFCED
CVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTIGSNKGCSQDFYAD
HLSLRYPLEISTTSGRLMCHFKLVATVGHLIRLSIESVQIEADNCVTDSLTIYDSLLPIR
STILYRICEPARTLKSFVSTNNLMLVTFKSPQVWRLSGIWAYFEVIPEQKCENTVLVKEI
TGFEGKISSPYYPSYCPPKCKCTWKFQSPLSTLGIALKFHNYSITKKSMKGCDHGWWEIN
DHTYCGSYMDHQTIFRVPSPLVHIQLQCSSRLSDKPLLVEYGSYNISQPCPVGSFRCSSG
VCVPQAQRCDGVNDCFDESDELFCVTLKPACNASSFGQQSPLICDGFQDCEDGQDEQNCT
RSIPCNDRTFKCGNDVCIRKQNAKCDGNVDCPDGTDEEGCRCSSSSPTLHRIIGGTDTQE
GGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGSRLSDPTPWTAHLGMNVQGNAKFI
SPVRRIVVHEYYNSQTFDYDIALLQLSVAWPETLKQLIQPICIPPAGQKVRSGEKCWVTG
WGRRHEADNKGSPILQQAEVELIDQTLCVSTYGIITSRMLCAGVMSGKKDACRGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences E1BCX6
ENSBTAP00000020053 ENSBTAP00000020053 9913.ENSBTAP00000020053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]