SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020080 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020080
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-43
Family Galectin (animal S-lectin) 0.000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020080   Gene: ENSBTAG00000015089   Transcript: ENSBTAT00000020080
Sequence length 135
Comment pep:known chromosome:UMD3.1:5:110014543:110017878:1 gene:ENSBTAG00000015089 transcript:ENSBTAT00000020080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGLVASNLNLKPGECLRVRGEVAADAKSFLLNLGKDDNNLCLHFNPRFNAHGDVNTIV
CNSKDAGAWGAEQRESAFPFQPGSVVEVCISFNQTDLTIKLPDGYEFKFPNRLNLEAINY
LSAGGDFKIKCVAFE
Download sequence
Identical sequences P11116
NP_786976.1.59421 NP_786976.1.76553 XP_005895280.1.15283 XP_006039730.1.26621 XP_006071443.1.26621 XP_010843380.1.44457 XP_019817329.1.53367 ENSBTAP00000020080 ENSBTAP00000020080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]