SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020111 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020111
Domain Number 1 Region: 19-204,311-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.07e-62
Family Calnexin/calreticulin 0.0000552
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.75e-46
Family P-domain of calnexin/calreticulin 0.000000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020111   Gene: ENSBTAG00000015114   Transcript: ENSBTAT00000020111
Sequence length 417
Comment pep:known chromosome:UMD3.1:7:13731958:13735788:-1 gene:ENSBTAG00000015114 transcript:ENSBTAT00000020111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPVPLLLGLLGLAAADRTVYFKEQFLDGDGWTERWIESKHKPDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPAGLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPNN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDDRAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPEYKGIWIHPEIDNPEYS
PDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLHEEEEEKKGKEEEEADKDDDEDKDEDEEDEDEKEEEEEEDAAAGQAKDEL
Download sequence
Identical sequences A5D7J6
ENSBTAP00000020111 ENSBTAP00000020111 9913.ENSBTAP00000020111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]