SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020200 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020200
Domain Number 1 Region: 149-305
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.8e-26
Family Dual specificity phosphatase-like 0.024
Further Details:      
 
Domain Number 2 Region: 11-122
Classification Level Classification E-value
Superfamily Starch-binding domain-like 8.1e-17
Family Starch-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020200   Gene: ENSBTAG00000015181   Transcript: ENSBTAT00000020200
Sequence length 331
Comment pep:known chromosome:UMD3.1:9:84028748:84136430:-1 gene:ENSBTAG00000015181 transcript:ENSBTAT00000020200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRFGVVVSPAVAGAGPELLVVGSRPELGRWEPSGAVRLRPAGTAAGAGALALQEPGLW
LGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDG
VYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL
KHELGVTAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYKEEGLAYIWMPTPDMSTEG
RVQMLPQAVCLLHALLEKGHTVYVHCNAGVGRSTAAVCGWLQYVLGWSRRKVQYFLVAKR
PAVYIDEEALARAEEDFYQKFGKIRSSVCGV
Download sequence
Identical sequences A5PK37
9913.ENSBTAP00000020200 ENSBTAP00000020200 NP_001093179.1.59421 NP_001093179.1.76553 XP_019823110.1.53367 ENSBTAP00000020200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]