SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020240 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020240
Domain Number 1 Region: 129-307
Classification Level Classification E-value
Superfamily MIR domain 2.18e-50
Family MIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 994-1107
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-19
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 3912-3990
Classification Level Classification E-value
Superfamily EF-hand 0.000000000756
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 572-720
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 13-94
Classification Level Classification E-value
Superfamily MIR domain 0.00000445
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 337-461
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000366
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2060-2125
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000968
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020240   Gene: ENSBTAG00000022886   Transcript: ENSBTAT00000020240
Sequence length 4870
Comment pep:known_by_projection chromosome:UMD3.1:28:10088109:10567332:1 gene:ENSBTAG00000022886 transcript:ENSBTAT00000020240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWI
IHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGS
EAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRSRTVHYEGGAVSVHARSLWRLETL
RVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKSLLLMDKEKADVKSTAFTFRSSKEKLDV
GVRKEVDGMGTSEIKYGDSVCYIQHINTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMD
DGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKASTVDLPIESVSLSLQDLI
GYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGR
EAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLV
ESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGR
DLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWAST
EGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLD
LSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYA
PCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLER
IREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETL
KTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLA
ENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLGY
GYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWCRP
GCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGE
ILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRLNFGKDVSTLKYFTICGLQEGYEPFA
VNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSSTDIM
FYRLSMPIECAEVFSKTAAGGIPGTGLFGPKNDLEDYDVDSDFEVLMKTAHGHLVPDRGD
RDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVLADERDDYDYL
MQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESI
KRSNCYMVCAGESLSPGQGRNNNGLEIGCVVDAASGLLTFTANGKELSTYYQVEPSTKLF
PAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMP
NQFLKVDVSRISERQGWLVQCMEPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRL
YSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRTGYYDLLIDIHLSSYATARLM
MNNEFIVPMTEETKSITLFPDEKKKHGLPGIGLSTSLRPRMQFSSPSFVSINTEGYQYSP
EFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGVFHNEDLK
HVLQLIEPSVFKEAASPEEESEVAEKEPFVEDSKLEGAAEEENKGAKRPKEGLLQMKLPE
PVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTAR
KTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDRSLDGN
NDLTIRGRLLSLVEKVTYLKKKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPEL
VRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEK
LMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFL
CYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREP
DLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVV
VRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAEDPSRDGPSPTTGSSKTPDTEEEEDD
TIHMGNAIMTFYSALIDLLGRCAPEMHLIHAAKGEAIRIRSILRSLIPLGDLVGVISIAF
QMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAA
SLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCS
LTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKY
YCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDY
MESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHAHDKWSMDKLANG
WIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMAL
YNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLEL
EAKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAVSSHPRGFKDLELDTPSI
EKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKN
HRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILG
QTLDARTVMKTGLESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYT
TVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGE
CLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAALNLPANVEDVCPNIPSLEKLMEE
IVDLAESGIRYTQMPHVMEVVLPMLCSYMSRWWEHGPENNPGRAEMCCTALNSEHMNTLL
GNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEE
DHLKSEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNQEAEDLFR
MVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLIMDTKSKMSKAAVSDQERKKMKRKGD
RYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQG
KLEDPAIRWQMALYKDLPNRTEDTSDPEKTVERVLDIANVLFHLEQKSTCMRRRYYNLVE
HPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFE
DKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAK
SCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAA
TLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGL
GMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDY
LLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAH
SRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGK
QMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKH
YTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQT
FLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVV
NEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEESEKEKPEEQGPRMGFFS
IMTVKSALFALRYNILTLMRMLSLKSLKKQMKKVKKMTVKDMITAFFTSYWSILMSLLHF
VASVFRGFSRIIGSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGERKTLEGA
LPSEDLTDLKELSEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPIPEVQE
KFQEQKAKEEEKEEKEESKSEPEKAEGEDGEKEEKAKEDKGKQKLRQLHTHRYGEPEVPE
SAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRS
SSENARVSSLDSSSPRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPL
VIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKY
GEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDN
SFLYLAWYMTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVV
VYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGD
EYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDY
FDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDC
FRKQYEDQLN
Download sequence
Identical sequences E1BHV1
ENSBTAP00000020240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]