SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020243 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020243
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.44e-95
Family Carbonic anhydrase 0.000000000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020243   Gene: ENSBTAG00000015214   Transcript: ENSBTAT00000020243
Sequence length 260
Comment pep:known chromosome:UMD3.1:14:79406494:79416487:-1 gene:ENSBTAG00000015214 transcript:ENSBTAT00000020243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
Download sequence
Identical sequences Q3SZX4
NP_001029609.1.59421 NP_001029609.1.76553 XP_019829388.1.53367 ENSBTAP00000020243 ENSBTAP00000020243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]