SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020285 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020285
Domain Number 1 Region: 30-547
Classification Level Classification E-value
Superfamily ALDH-like 8.38e-122
Family ALDH-like 0.000000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020285   Gene: ENSBTAG00000030335   Transcript: ENSBTAT00000020285
Sequence length 563
Comment pep:known chromosome:UMD3.1:2:134345970:134380241:1 gene:ENSBTAG00000030335 transcript:ENSBTAT00000020285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRSAALCRALLARRGRAAGLCRRCVSSLQVANEPVLAFTQGSPERDALQKALKELKGR
TEAIPCVVGDEEVWTSDVRYQASPFNHGHKVAKFCYADKALLHRAIGAALAARKEWDLKP
VADRAQVFLKAADLLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAMEL
EGEQPLSVPPSTNSMLYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFRTFPRLAGECGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYAPRSL
WPQIKGRLLEELGGIKVGNPAEDFGTFFSAVIDAKSFGRIRKWLEHARSSPSLTILAGGH
CDDSVGYFVEPCIVETKDPQDPIMKEEIFGPVLAVYVYPDEEYKETLRLVDSTTSYGLTG
AVFAQDKDVLREATELLRHAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYVLR
WTSPQVIKETHGPLGDWRYPYMQ
Download sequence
Identical sequences A7YWE4
9913.ENSBTAP00000020285 NP_001099116.1.59421 NP_001099116.1.76553 ENSBTAP00000020285 ENSBTAP00000020285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]