SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020299 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020299
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-36
Family Galectin (animal S-lectin) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020299   Gene: ENSBTAG00000015260   Transcript: ENSBTAT00000020299
Sequence length 141
Comment pep:novel chromosome:UMD3.1:18:49578803:49580639:1 gene:ENSBTAG00000015260 transcript:ENSBTAT00000020299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLPNPYQQSVSLAVGFMVKITGNLESSCGLCGNNPEVVVDFCMGIEEGSNIAFHFRVY
TNSMVVMNSFQEGGWQEEKRMFSDPFMPGQPFELRFLVLENEYKVFVNNESFCQFAHRLP
IQSVKMLKVRGDTVLTSVDTF
Download sequence
Identical sequences F1MUF2
ENSBTAP00000020299 ENSBTAP00000020299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]