SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020360 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020360
Domain Number 1 Region: 3132-3204
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1748-1817
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.97e-19
Family TB module/8-cys domain 0.00061
Further Details:      
 
Domain Number 3 Region: 2483-2554
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-18
Family TB module/8-cys domain 0.00039
Further Details:      
 
Domain Number 4 Region: 2847-2918
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 493-615
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-18
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 6 Region: 2925-3059
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 404-534
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 2644-2770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 291-353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.03e-16
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 10 Region: 613-686
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-16
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 11 Region: 3247-3375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.51e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 1910-2048
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.34e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1824-1954
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 14 Region: 139-224
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000106
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 15 Region: 2114-2249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000018
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 16 Region: 2323-2396
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 17 Region: 1646-1727
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000366
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2205-2333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000643
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 19 Region: 3018-3134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000879
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 20 Region: 3372-3488
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 21 Region: 2402-2457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000268
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 22 Region: 3207-3252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 23 Region: 656-768
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000832
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 24 Region: 2035-2091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000141
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 25 Region: 2808-2861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000017
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 26 Region: 180-298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000628
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 27 Region: 2561-2615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000653
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 28 Region: 2763-2805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000395
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 29 Region: 1248-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.01
Further Details:      
 
Domain Number 30 Region: 2604-2642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020360   Gene: ENSBTAG00000015307   Transcript: ENSBTAT00000020360
Sequence length 3672
Comment pep:known_by_projection chromosome:UMD3.1:7:26697477:26917267:1 gene:ENSBTAG00000015307 transcript:ENSBTAT00000020360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMC
TCSSGQISPTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVCENGCQNGGRC
IGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATTGRAWGHP
CEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECKCPAGHKQS
ETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCIGLDQRTGTCFS
GLVNGRCAQELPGRMTRMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCLDGLPIGGIPG
SAGSRPGSAGGNGFAPSGNGNGYGPGGAGFIPIPGGNGFSPGVGAILNQTIDICKHHANL
CLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTSNPCTNGDCVNTPGSYYCKCHAGF
QRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICNAGFELTTDGKNCVDHDECTTT
NMCLNGMCINEDGSFKCICKPGFILAPNGRYCTDVDECQTPGICMNGHCINNEGSFRCDC
PPGLAVGVDGRVCVDTHMRSTCYGGIKKGVCVRPFPGAVTKSECCCANPDYGFGEPCQPC
PAKNSAEFHGLCSSGVGITVDGRDINECALDPDICANGICENLRGSYRCNCNSGYEPDAS
GRNCVDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGYVFRTETETCEVADKISDFCLFGF
PFLKPISFFCSESYMNKFRIICCMTTGHYSFSVALCGPTEVSHDILKSNIWNNPFLNILK
YLFPGNFIAKKAAIVISCKKMLTFSSSCLISKHSYEQKQLRTQTRCRNTDDSAEVNEMQL
QRAPQREAYFPFLTKVLEDSFILSIDEQRFILSIDEQRHLLVFFFLLVSCFISPGFPSVC
IQSFYLLAPIPTLRSSESNYNLGYHLHLKLVSLSSDRTLLCHCEGDTAGSYMDGFGLNTR
LSIFIAHCFHFDKKEIDLKAMEIFSPWVSSLFPALHSHDKFVCLKQFSACYSLSLYIFAI
CTNFTCHSCFQQSILIYFQECTVNCFSSWFHDIYNIKTMYLKLCFFFFFIERNLRTCIKL
FNTQINDSKNLFNTIKSLFFLFFYFSTMSCALKWSHTVSNQTWKCEQEGWRRAGREGSTW
ESEFEFPTEQADSCRPAESPSCAHVYPCCKMHVSIPQTHGSSNRIFSFWIVDINECESNP
CVNGACRNNLGSFNCECSPGSKLSSTGLICIVVFSCYPGLTCFNVSQNVEGQFLIKACEI
YYNVTISNSSAYVREKTDLSSSFLLLVSKATLTRYTYFTFLPSIHFCELNIYFQIGRRND
EGITFFLTEFLVGGGGGAYGLDLSFCFIINTSGILASYSYRLLCWTPKPHNIFLSQCIIF
PHLWLGSEFCPHISWTQQVTYIPIHTQEETIRRDGLCMNTVALHCHLCFLYAMEFAADTN
AYEQISFICAQFLSKLNLKIEKSRLPISSSHPCPIALCLQSRTEVFPLFYPSGYIVFIVK
PYWSLLLTFCSIILHITCRETISGAFHMWTPRPHIRRICILTLHFKIISNISMVCLNGGF
KGFISFFIFKISFFKLFIKTELYFLQSLKGTCWLNIQDNRCEVNINGATLKSECCATLGA
AWGSPCERCELDTACPRGFARIKGVTCEDVNECEVFPGVCPNGRCVNSKGSFHCECPEGL
TLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKFRMDACCCAVGAAWGTECEECPKLGTK
EYETLCPRGPGFANRGDVLTGRPFYKDINECKAFPGMCTYGKCRNTIGSFKCRCNSGFAL
DMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYESGFMMMKNCMDIDECERNP
LLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDINECSLSDNLCRNGKCVNMIGTYQCS
CNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNAEGSYECSCSEGYALMPDGRSCADIDE
CENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVNECDLNSNICMFGECENTKG
SFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNVPGSFKCSCREGWVGNGIKC
IDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTCSDVDECAENINLCENGQCL
NVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCNNLPGMFHCICDDGYELDRT
GGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPTGVGCVDNRVGNCYLKFGPR
GDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNSTEYYTLCPGGEGFRPNPITI
ILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEETRICEDIDECFAHPGVCGPG
TCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGTTCENELPFNVTKRMCCCTY
NVGKAWNKPCEPCPAPGTADFKTICGNIPGFTFDIHTGKAVDIDECKEIPGICANGVCIN
QIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADCINSPGSYRCECAAGFKLSP
NGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQDQTMCMDVDECERHPCGNG
TCKNTVGSYNCLCYPGFALTHNNDCMDIDECSSFFGQVCRNGRCFNEVGSFKCLCNEGYE
LTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYEVKSENCIDINECDEDPNI
CLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTNFENGKCSVPKAFNTTKAKC
CCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDTREDVNECLESPGICSNGQ
CINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTCTNVIGSFECNCNEGFEPG
PMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQKMCKDLDECAEGLHDCE
SRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGICENGRCVNTIGSYRCECN
EGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSSRNLVTKSECCCDGGRGWGHQCELCP
LPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTSGQCINTMGSFRCFCKVGYTTDISG
TSCVDLDECSQSPKPCNFICKNTEGSYQCSCPRGYVLQEDGKTCKDLDECQTKQHNCQFL
CVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNTPGSFSCECQRGFSLD
ATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQWNQCVDENECSNPNACGS
ASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNYGCSNTEGGYLCGCPPGYY
RVGQGHCVSGMGFNKGQYLSMDTEVDEENALSPEACYECKINGYSKKDNRQKRSIHEPKH
IASEDPSKVKQISLESVDMDSPVMMKFNVSGLGAKEHIVEFMPAIEPLNNHIRYVISQGN
DDGVFRIHQRNGLSYLHTAKRKLVPGMYTLEITSVPLYKKKELKKLEDSNEDDYLLGELG
EALRMRLQIQLY
Download sequence
Identical sequences F1MTZ4
ENSBTAP00000020360 ENSBTAP00000020360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]