SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020455 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020455
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-74
Family Ephrin receptor ligand binding domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 592-884
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.49e-66
Family Protein kinases, catalytic subunit 0.00000000202
Further Details:      
 
Domain Number 3 Region: 300-505
Classification Level Classification E-value
Superfamily Fibronectin type III 7e-39
Family Fibronectin type III 0.00000236
Further Details:      
 
Domain Number 4 Region: 877-948
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.36e-19
Family SAM (sterile alpha motif) domain 0.00019
Further Details:      
 
Domain Number 5 Region: 230-303,338-358
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000262
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020455   Gene: ENSBTAG00000015377   Transcript: ENSBTAT00000020455
Sequence length 953
Comment pep:known_by_projection chromosome:UMD3.1:1:135191077:135518801:-1 gene:ENSBTAG00000015377 transcript:ENSBTAT00000020455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRGA
HRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAA
DESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQN
FAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPE
NSVACKACPAGMFKASQEAEVCSHCPSNSRSPSEASPICTCRTGYYRADFDPPEVACTSV
PSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPR
QLGLTECRVSISSLWAHTPYTFDIQAVNGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQ
VSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVY
VVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPLIAGSAAAGVVFVVSLVAISIV
CSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIE
EVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIR
LEGVVTKSRPVMIITEFMENGALDSFLRAQELKPSSMPYALAKKVGLLYYLHRSLASGQL
VNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYG
IVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRF
AEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDS
FLTAGFTSLQLVTQMTSEDLLRIGVTLAGHQKKILNSILSMRVQMSQSPTAMA
Download sequence
Identical sequences F1MII5
ENSBTAP00000020455 ENSBTAP00000020455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]