SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020608 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020608
Domain Number 1 Region: 187-484
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.94e-41
Family NadC C-terminal domain-like 0.027
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000020608
Domain Number - Region: 10-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.000353
Family NadC N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020608   Gene: ENSBTAG00000015509   Transcript: ENSBTAT00000020608
Sequence length 491
Comment pep:known chromosome:UMD3.1:4:47597860:47635332:-1 gene:ENSBTAG00000015509 transcript:ENSBTAT00000020608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKIRKVKYEETVFY
GLQYILHKYLKGKVVTKEKIQEAKEVYREHFQDDVFNEKGWNYILEKYDGHLPIEVKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWVETILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKTWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLDILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
QLNIELEAAPH
Download sequence
Identical sequences F1MJ80 W5P316
NP_001231070.1.59421 NP_001231070.1.76553 XP_004007891.1.66739 XP_011993232.1.54773 XP_017902721.1.57651 XP_019814229.1.53367 ENSOARP00000004816 ENSBTAP00000020608 9913.ENSBTAP00000020608 ENSBTAP00000020608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]