SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020701 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020701
Domain Number 1 Region: 13-227
Classification Level Classification E-value
Superfamily Heme oxygenase-like 4.45e-72
Family Eukaryotic type heme oxygenase 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020701   Gene: ENSBTAG00000015582   Transcript: ENSBTAT00000020701
Sequence length 289
Comment pep:known chromosome:UMD3.1:5:73980776:73987841:1 gene:ENSBTAG00000015582 transcript:ENSBTAT00000020701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPQPDSSMPQDLSEALKEATKEVHTQAENAEFMKNFQKGELTQEGFKLVMASLYHIYV
ALEEEIERNKENPVYTPLYFPEELHRRASLEQDMAFWYGPRWQEAIPYTQATKRYVQRLQ
EVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALNLPSSGEGLAFFTFPNIASATKFK
QLYRSRMNTLEMTPEVRQRVLDEAKTAFLLNIQLFEELQGLLTQKAKDHDPLQAPELHRR
AGSKVQDLAPTKASRGKPQPSVLSQAPLLRWVLTLSFLVATVAVGLYAM
Download sequence
Identical sequences Q5E9F2
ENSBTAP00000020701 NP_001014912.1.59421 NP_001014912.1.76553 ENSBTAP00000020701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]