SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020801 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020801
Domain Number 1 Region: 915-1025
Classification Level Classification E-value
Superfamily SEA domain 1.09e-18
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 248-342
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000392
Family SEA domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000020801
Domain Number - Region: 1074-1116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0119
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020801   Gene: ENSBTAG00000015662   Transcript: ENSBTAT00000020801
Sequence length 1257
Comment pep:known_by_projection chromosome:UMD3.1:1:46088714:46161410:-1 gene:ENSBTAG00000015662 transcript:ENSBTAT00000020801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPHFGKISLCILIFVLIEGNLPSLTEEIQEPKSTVSFLQTDSESTDSSLSAKKKQPL
DSRETERHWLLRRKRSTLFPNGVKTCPDESVTEAVANHVKYFKVRVCQEAVWEAFRTFWD
RLPGREEYHYWMNLCEDGITTIFEMGTHFSQSVEHRSLIMQKLTYAKETVSGSCSYNQAC
GSELSSPVPVGDMSTLGDAGLSVPYPGVTSYEGISESSLERPEDSISNEIENVVEESTKT
AAEQVAEFSIHLLGEQYNEELQDPSSFHHQRLVEDFISEVENAFTGLPGYKDIRVLDFRS
PKENGSHSGIDVHYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTAVYTISNFR
DYIAETLHQNFLLGSSSLNPDPDSLQLINVRGVLLPQSEDQVWNTQSSSLQQALPSILDN
TPQAEWPSADESTTSSISPLGFSSGLPSATGRELWSESPLGDLVSTPKLAFPSKVSLSSS
PEVLDVSGLTLHSVTPAVLQTDLPVASEERTSGSHSLEDGLMKVEVSEDFLSINPLPSSP
FTYPVPKETPPSMEDSGVSLPSSPYPVSSVTFDLLAKEVTTPFGMDSLASKVKDQLEVSS
WMPDTTMEKEFMFESGLGSGSGQKIDLITWPWSETSLEKSTEPLSKSWLEVEDSLLLTEG
IDVKPVIDDKIDSADQRAEHSEYGPFDGSTNFAEDEPLGGPTVSLFAETTTQSASPVLPK
HTSEVPDIDYYSVTKSPPLLTFVAVSASIDKADQVEHFLKEDMEQTTESFNHEWFDSKIS
IEKSDVQPLRTTVPESDVFWARTSPLGKLSRDTLASTPQSTDKLWLKASMTQSTKLPSTI
SSTLLEDEVIMGVQDISLELDQIGTDYYQPELIPEESGMVGSYVEMSTNIHSTEMAVVAQ
PTRSDDLSHTQAVGAVVVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNL
TGFQNLEILNFRNGSIVVNSRMKFTRSVLPNVTNAVYVILEDFCTTAYQTMNLAIDKYSL
DVESGDQANPCKFQACNEFSECLVNPWSGEAECRCYPGYLSVEDLPCQSLCDLQPNFCLN
DGKCDIMPGHGAICRCRVGENWWYRGEHCEEFVSEPLVIGVTIASMIGLVLISSAVVFFI
IKALQAQYVRRERERPSSSSRQRDGLSSVERAVKHNPVFESYEADLEQYEGPYPQRPFYS
STDREMIAGLSREEIRQMYENSDLSREEIQERMRILELYARDPEFAAFVREHQMEEL
Download sequence
Identical sequences E1BBU2
9913.ENSBTAP00000020801 ENSBTAP00000020801 ENSBTAP00000020801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]