SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020860 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020860
Domain Number 1 Region: 12-128
Classification Level Classification E-value
Superfamily BTG domain-like 7.46e-47
Family BTG domain-like 0.000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020860   Gene: ENSBTAG00000015711   Transcript: ENSBTAT00000020860
Sequence length 162
Comment pep:known_by_projection chromosome:UMD3.1:16:890072:892370:1 gene:ENSBTAG00000015711 transcript:ENSBTAT00000020860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSQTRRAEGRADMLPEIAAAVGFLSSLLRTRGCVNEQRLQVFRGALQAALTEHYKHHWFP
EKPSKGSGYRCIRINHKMDPIISKVASQIGLSQPQLHRLLPSELTLWVDPYEVSYRIGED
GSICVLYQEAPVATSYGLLTCKNQMILGRSSPSKNYIMAVSS
Download sequence
Identical sequences F1MNK6
ENSBTAP00000020860 ENSBTAP00000020860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]