SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000020897 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000020897
Domain Number 1 Region: 343-473
Classification Level Classification E-value
Superfamily C-type lectin-like 1.61e-41
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 200-336
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 793-919
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-34
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 4 Region: 484-619
Classification Level Classification E-value
Superfamily C-type lectin-like 8.42e-34
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 931-1081
Classification Level Classification E-value
Superfamily C-type lectin-like 5.74e-33
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 6 Region: 627-777
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-28
Family C-type lectin domain 0.00048
Further Details:      
 
Domain Number 7 Region: 1220-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 8 Region: 1092-1214
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-25
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 6-137
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7e-24
Family Cysteine rich domain 0.0037
Further Details:      
 
Domain Number 10 Region: 137-195
Classification Level Classification E-value
Superfamily Kringle-like 2.23e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000020897   Gene: ENSBTAG00000015739   Transcript: ENSBTAT00000020897
Sequence length 1443
Comment pep:known chromosome:UMD3.1:19:47721711:47747246:1 gene:ENSBTAG00000015739 transcript:ENSBTAT00000020897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFLPEPNVFVIFSHGLQGCLEAQGGQVRVSPACNASLPAQRWKWVSRNRLFNLGTMQCLG
TGWPGTNTTASLGMYECDREALSLRWNCRTLGDQLSLLLGGRVGNTSKAGSPERGDQTRS
GQWRIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCAT
TQDYGKDERWGFCPIKGNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLS
ITEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENC
GVIRTESSGGWQNRDCSIALPYVCKKKPNATASEPPPPDVWANVKVECEPSWQPFQGHCY
RLQAEKRSWQESKKMCLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFE
WSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGA
AEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYN
WDGEYFWTALQDLNFTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKN
CTSFRARYICRQSLGTPVTPELPGLDPTPSLTGACPQGWGSDPKLRHCYKVFSSERLQDK
KTWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPG
AGQSWRWSDGLGFSYHNFDRSRHDDDDIRSCTVLDLASLQWVAMQCETQLDWICKIPRGT
DVREPDVSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELVSVHSQAELDFLGH
NLQKFSRGQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMMASR
EDWGDQRCTTALPYICKRRNSTREQQPPDLPPTGGCPSGWSQFLNKCFRIQGQDPQDRVK
WSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDLWIGLHASKRDFQWVEQEPLQYA
NWAPGEPSGPSPAPSGNIPTSCAVVLHSPSTHFTGRWDDRSCAEETHGFICQKATDPSLS
PSPAASPPAPGAELSYLNGTFRLLQKPLRWHDALLLCESRNASLAHVLDPYTQAFLTQAA
RGLRTPLWIGLASEEGSRRYSWVSEEPLSYVSWQDGEPQHPGGCAYVDTDGAWRTTSCDT
KLQGAVCGVHGGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQ
RAGGAVLSILDEMENVFVWEHLQSSEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGP
PGLGPSMLSHNSCYWIQSSSGLWRPGACTNISMGVVCKLPRAEASSFSPSALPENPAALV
VVLMAVLLLLALLTAALILYRRRQSVERGAFEGARYSRSSSGPSEATEKNILVSDMEMNE
QQE
Download sequence
Identical sequences F1MPD1
ENSBTAP00000020897 9913.ENSBTAP00000020897 ENSBTAP00000020897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]