SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021025 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021025
Domain Number 1 Region: 36-148
Classification Level Classification E-value
Superfamily FKBP-like 6.09e-37
Family FKBP immunophilin/proline isomerase 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021025   Gene: ENSBTAG00000015828   Transcript: ENSBTAT00000021025
Sequence length 202
Comment pep:known chromosome:UMD3.1:5:31048546:31052006:1 gene:ENSBTAG00000015828 transcript:ENSBTAT00000021025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLLPLRLLLLLLLLRGAVCQAEAGSETESPVRTLQVETLVEPPEPCAEPATFGDT
LHIHYSGSLVDGRIFDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRVIIPSHLAY
GKRGFPPSIPADAELHFDVELIALIRANYWQKLVKGILPLVGMAMVPALLGLIGYHLYRK
ASSPKISKKKLKEEKRNKSKKK
Download sequence
Identical sequences F1MT51
ENSBTAP00000021025 XP_019816230.1.53367 ENSBTAP00000021025 9913.ENSBTAP00000021025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]