SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021138 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021138
Domain Number 1 Region: 14-90
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000653
Family Clathrin adaptor core protein 0.079
Further Details:      
 
Domain Number 2 Region: 143-202
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000435
Family HMA, heavy metal-associated domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021138   Gene: ENSBTAG00000015901   Transcript: ENSBTAT00000021138
Sequence length 282
Comment pep:known chromosome:UMD3.1:14:31695684:31720448:-1 gene:ENSBTAG00000015901 transcript:ENSBTAT00000021138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSSSTMNEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSAL
LALRYLAECRANREKMKGELGMMLSLQNVIQKSTTPGETKLLASEIYDILQSSNMADGDS
FNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAV
QRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDY
LPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSFYW
Download sequence
Identical sequences L8IT79 Q3ZBE1
ENSBTAP00000021138 NP_001015594.2.59421 NP_001015594.2.76553 XP_005689077.1.57651 XP_005893013.1.15283 XP_010846785.1.44457 XP_011994322.1.54773 XP_011994323.1.54773 XP_019829445.1.53367 ENSBTAP00000021138 9913.ENSBTAP00000021138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]