SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021162 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021162
Domain Number 1 Region: 6-331
Classification Level Classification E-value
Superfamily L domain-like 3.89e-69
Family Internalin LRR domain 0.037
Further Details:      
 
Domain Number 2 Region: 351-501,562-613
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000285
Family G proteins 0.0059
Further Details:      
 
Domain Number 3 Region: 619-681
Classification Level Classification E-value
Superfamily Polo-box domain 0.0000549
Family Swapped Polo-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021162   Gene: ENSBTAG00000015913   Transcript: ENSBTAT00000021162
Sequence length 925
Comment pep:known_by_projection chromosome:UMD3.1:27:24100833:24103670:-1 gene:ENSBTAG00000015913 transcript:ENSBTAT00000021162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPANIGDIEVLNLGNNGLEEVPDGLGSALGSLRVLVLRRNRFAQLPQAVAELGHHLTELD
VSHNRLSVLGAEAVGALRELRKLNLSHNQLPALPAQLGALVHLEELDVSFNRLAHLPDSF
AGLSRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGA
ELGTLPSGFCELASLESLMLDNNGLRALPAQFSRLQRLKMLNLSSNLLEEFPAALLPLAG
LEELYLSRNQLTSVPCLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIAVL
PDNFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGQ
KAAGKTLLRHCLTEDRVEGKLGGGGQEKTYPPSPPPGSKGIEVTSWTADASRGLRFIVYD
LAGDERYEVIQPFFLSPGALYVLVVNLATYEPLRFPTTVGSFLHRVGARVPHAVVCIVGT
HADLCGEQELEEKCLDIHRQIALQEKHDAEGLSRLAQVVDEALARDFELRSASPHAAYYG
VSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPRQLQRLRDKLLSVAEHREIFPNLHR
VLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTEDRLQSALSYLHESGKLLYFE
DSPALKEHVFHNLSRLIDILNVFFQRDPSLLLHKLLLGTSEDALRATQLHHYVEGFLLHG
LLPAHVIRLLLKPHVQAQQDLQLLLELLEKMGLCYCLNKAKGKPLNGSTAWYKFPCYVQN
EVPHAEAWINGTNLAGQSFVAEQLQIEYSFPFTFPPGLFARYSVQINNHVVHRSDGKLQI
FAYRGKVPVVVSYRPAKGVLQPDTLSIASHASLPNIWTAWQAITPLVEELNVLLQEWPGL
HYTVHILCSKCLKRGSPNPHAFPGK
Download sequence
Identical sequences F1N7Y7
ENSBTAP00000021162 ENSBTAP00000021162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]