SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021183 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021183
Domain Number 1 Region: 36-184
Classification Level Classification E-value
Superfamily L domain-like 1.63e-34
Family Internalin LRR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021183   Gene: ENSBTAG00000015930   Transcript: ENSBTAT00000021183
Sequence length 190
Comment pep:known chromosome:UMD3.1:10:85467722:85504542:1 gene:ENSBTAG00000015930 transcript:ENSBTAT00000021183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKATTIKEALARWEEKTSQKPSEAREIKLYAQIPPIEKMDASLSTLSNCEKLSLSTNCI
EKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHVMKKLKIL
YMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAEGNWVEEATKRVPKLKKLDGTP
VIKEDEEEDN
Download sequence
Identical sequences Q2KID4 W5NR55
ENSOARP00000000645 ENSBTAP00000021183 9913.ENSBTAP00000021183 NP_001039892.1.59421 NP_001039892.1.76553 XP_004010826.1.66739 XP_005686112.1.57651 XP_005893878.1.15283 XP_006046633.1.26621 XP_010854082.1.44457 XP_011966954.1.54773 XP_015328729.1.76553 XP_019824758.1.53367 XP_019824759.1.53367 ENSBTAP00000021183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]