SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021192 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000021192
Domain Number - Region: 398-464
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000561
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021192   Gene: ENSBTAG00000015936   Transcript: ENSBTAT00000021192
Sequence length 761
Comment pep:known_by_projection chromosome:UMD3.1:8:110409332:110605777:-1 gene:ENSBTAG00000015936 transcript:ENSBTAT00000021192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWRFVELLYFLFVWGRISVQPSHQEPAATDQHVSKEFDWLISDRGPFHHSRSYLSFVER
HRQGFTTRYKIYREFARWKVRNTAIERRDLVHHPVPLMPEFQRSIRLLGRRPTTQQFIDT
VIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMR
RLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQE
KFVQSALSYIMCNGEGEYVCQNSQCRCQCAEEFPQCNCPITDIQIMEYTLASMAKSWAEA
YKDLENSDEFKSFMKRLPSNHFLTIGSIHQHWGNDWDLQNRYKLLQSAMEAQRQKIQRTA
RKLFGLSVRCRHNPNHQLPRERTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTT
LCQRPIPCIIGGNNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETD
LDFQDLELKYLLQKMDSRLYVHTTFISNEIRLDTFFDPRWRKRLSLTLKSNKNRMDFIHM
VIGMSMRICQMRNSSLDPMFFVYINPFSGSHSEGWNMPFGEFGYPRWEKIRLQNSQCYNW
TLLLGNRWKTFFETVHIYLRSRTRLPTLLRNETGQGPVDLSDPSKRQFYIKISDVQVFGY
SLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIRDRINRLAPPVAPGKPQLDLF
SCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC
Download sequence
Identical sequences F1N6R0
ENSBTAP00000021192 9913.ENSBTAP00000021192 ENSBTAP00000021192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]