SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021257 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021257
Domain Number 1 Region: 405-516
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 587-693
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-19
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 699-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000862
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 758-820
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000288
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 345-410
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 825-885
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000131
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 7 Region: 521-584
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 228-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000327
Family Spermadhesin, CUB domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021257   Gene: ENSBTAG00000015979   Transcript: ENSBTAT00000021257
Sequence length 983
Comment pep:known_by_projection chromosome:UMD3.1:19:20879077:20927187:-1 gene:ENSBTAG00000015979 transcript:ENSBTAT00000021257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAALLLLPSLLALLVHGLSLEAPTEGEGQAPGLEEMDGELTAAPTPEQPEPGVHFVTT
APTLKLLNHHPLLEEFLQEGQEKDELRPDPPTASPLPRLANQDSRPVFTSPTPVMVAAPT
QPQSREGPWSLESEPPALRITVALPPGPGMAVPTPGPGERPNTPPPSGAWTPTPEGPGDI
GRPWAPGVMSQTTGLGMEGTVATSTASGDDEETTSTSTIITTAVTTVQPPGPCSWNFSGP
EGSLDSPTASNSPPDVGLDCFYYISVYPGYGVEIKVQNISLREGETVTVEGLGGPDPLPL
ANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFPRRPAYGAVTVT
SLHPGGSARFRCATGYQLKGARLLTCLNATQPFWDSQEPVCIAACGGVIRNATTGRIVSP
GFPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVE
YLPIEGLLSSSRHFFVELSTDSSGVAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPSYPV
GTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGETTDSAGVVLSPNWPE
PYGRGQDCIWGVHVEEDKRIMLDVRVLRIGTGDVLTFYDGDDLTARVLGQYSGPRGHFKL
FTSMADVTIQFQSDPGASVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHG
TVVTYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCLDPGDVEHSRRLISSPKFPV
GATVQYICDQGFVLTGSALLTCHDRQASSPKWSDRAPKCLLEQLKPCHGLSAPENGARSP
EKRLHPAGATVHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDGFYSGRSLDV
AKVPAASSTLDAAHLAAAIFLPLVAMALLVGGVYLYFCRLQGNSPLQLPRTRPRPYDRIT
VESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences F1N649
ENSBTAP00000021257 ENSBTAP00000021257 9913.ENSBTAP00000021257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]