SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021260 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021260
Domain Number 1 Region: 2-355,385-404
Classification Level Classification E-value
Superfamily Thiolase-like 6.68e-76
Family Thiolase-related 0.0024
Further Details:      
 
Domain Number 2 Region: 2226-2502
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.15e-64
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000734
Further Details:      
 
Domain Number 3 Region: 1640-1806
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.48e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.00012
Further Details:      
 
Domain Number 4 Region: 492-617,680-778
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.43e-40
Family FabD-like 0.0043
Further Details:      
 
Domain Number 5 Region: 1884-2098
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.11e-34
Family Tyrosine-dependent oxidoreductases 0.00018
Further Details:      
 
Domain Number 6 Region: 1264-1407
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000000066
Family UbiE/COQ5-like 0.053
Further Details:      
 
Domain Number 7 Region: 1560-1675
Classification Level Classification E-value
Superfamily GroES-like 0.000000000000108
Family Alcohol dehydrogenase-like, N-terminal domain 0.0047
Further Details:      
 
Domain Number 8 Region: 2126-2189
Classification Level Classification E-value
Superfamily ACP-like 0.000000000089
Family Acyl-carrier protein (ACP) 0.00017
Further Details:      
 
Domain Number 9 Region: 617-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000314
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021260   Gene: ENSBTAG00000015980   Transcript: ENSBTAT00000021260
Sequence length 2512
Comment pep:known_by_projection chromosome:UMD3.1:19:51384922:51403614:1 gene:ENSBTAG00000015980 transcript:ENSBTAT00000021260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVITGMSGKLPESENLEEFWANLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHNMDPQLRLLLEVTYEAIVDAGINPASIRGTNTGVWVGVSGSEASEAL
SRDPETLVGYSMVGCQRAMLANRLSFFFDFKGPSITLDTACSSSLLALQRAYQAIQRGEC
AMAIVGGVNILLKPNTSVQFMKLGMLSPEGTCKSFDASGNGYCRAEAVMAILLTKKSLAR
RVYATILNAGTNTDGCKEKGVTFPSGEAQEQLISSLYKPAGLDPETLEYVEAHGTGTKVG
DPQELNGIVQALCGTRQSPLRIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
NPNPKIPALQDGRLQVVDRPLPVLGGNVGINSFGFGGSNVHVILQPNSQPLPPPAPHAAL
PRLLRASGRTLEGVQGLLELGLQHSQNLAFVSMLNDIAAPSPAAMPFRGYAVLGSQGGSQ
EVQQVLAGKRPLWFICSGMGTQWRGMGLSLMRLSRFRDSILRSDEAVKPLGLQVSQLLLS
TDEAIFDDMVISFVSLTAIQIALIDLLTSMGLQPDGIIGHSLGEVACGYADGCISQEEAI
LSAYWRGQCIKEANIPPGAMAAVGLTWEECKQRCPPGIVPACHNCIDTVTISGPQASMLE
FVQQLKQEGVFAKEVRTGGMAFHSYFMDAIAPMLLQQLKKVIREPQPRSPRWLSTSIPET
QWQESLARTFSAEYNVNNLVSPVLFQEALWRVPEDAVVLEIAPHALLQAVLKRGLKSSCT
IIPLMKKDHRDNLEFFLSNVGQLYLTGIDVNPNGLFPPVEFPAPRGTPLISPHIKWDHSQ
TWDVPTAEDFPSGSSSSSATIYKIDINPESPDHYLVDHCIDGRIIFPGTGYLCLVWKTLA
RALDQNMEHTPVVFEDVTLHQAVILPKTGIVLLEVRLLEASCTFEVSENGNLIASGKVYQ
WEDPNPKLFDNRYGPDPATPVDPTTAIHLCRGDVYKELQLQGFNYGPYFQGILEASSEGN
TGQLLWKDNWVTFMDTMLQMSILAPSKRSLRLPTRITAIYIHPATHQQKLYTLQDKTQVA
DVVINRCLDTTVAGGIYISRIHTSVAPRHQQEQLVPILEKFCFTPHVETGCLAGNLALQE
ELQLCVGLAQALQTRVAQQGIKMVVPGLDGAQAPQEAPQQGLPRLLATACQLQLNGNLQM
EMGQILAQERALLCDDPLLSGLLNSPALKACVDTALENMTSLKMKVVLAGDGQLYSRIPT
LLNTQPLLELDYTATDRHPQALEAAQAKLQQLDITQGQWDPSDPAPSNLGGANLVVCNYA
LASLGDPATAVGNMVAALKEGGFLLLHTLLRGHPLGETVTFLTCPEPQQGQRHLLSQDEW
ERLFAGASLYLVALKKSFYGSVLFLCRRLAPLDSPIFLPVEDTSFQWVDSLKNILADSSS
RPVWLMAVGCTTSGVVGLVNCLRKEPDGHRIRCVLVSNLNSTSPIPETDPKSLELQKVLQ
SDLVMNVYRDGAWGAFRHFPLEQDKPEEQTEHAFINVLTRGDLSSIRWVCSPLRHSQPTA
PGFQLCTIYYASLNFRHHAGHGQAVPRRHPRNWASRNCLLGMEFSGRDASGKRVMGLVPA
EGLATSTLVPQSFLWDVPSNWTLEEAASVPVVYSTAYYALMVRGRMQPGETVLIHSGSGG
VGQAAIAIALSLGCRVFTTVGSAEKRAYLQSRFPQLNETSFANSRDTSFEQHVLWHTAGK
GADLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSKNHPLGMAIFLKNVTFHGILLDSL
FEENNTMWQEVSTLLKAGIREGVVQPLKRTVFPRTQAEDAFRYMAQGKHIGKVVLQVREE
EQEAVLHGTKPTQMVALCKTFCPAHKSYIITGGLGGFGLELAHWLVERGAQKLVLTSRSG
IRTGYQARQVHEWRRQGVQVLVSTSDVSALDGTRSLITEAAQLGPVGGIFNLAVVLRDAM
LDNQTPEFFQDVNKPKYNGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQTNYGFANS
TMERICEKRRHDGLPGLAVQWGAIADVGLLMELKGTKDKAIGGTLPQRITSCMEVLDLFL
NQPHPVLSSFVLAEKATSRGPSGSHQDLVKAVTHILGIRDLATVNLDSSLSDLGLDSLMG
VEVRQMLEREHNLLLSMREIRQLTIHKLQEISAQAGTADELTDSTPKFGSPAQSQTQLNL
STLLVNPEGPTLTRLNSVQSSERPLFLVHPIEGSTTVFHSLAAKLSIPTYGLQCTGAAPL
DSIQSLATYYIECIRQVQPEGPYRIAGYSYGACVAFEMCSQLQAQQNAGPTNNSLFLFDG
SHTFVMAYTQSYRAKLNPGCEAEAEAEAMCFFMQQFTEAEHSRVLEALLPLGDLEARVAA
TVELIVQSHAGLDRHALSFAARSFYHKLRAAEEYTPRATYHGNVTLLRAKMGSAYQEGLG
ADYNLSQVCDGKVSVHIIEGDHRTLLEGSGLESILSIIHSSLAEPRVSVREG
Download sequence
Identical sequences F1N647
ENSBTAP00000021260 ENSBTAP00000021260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]