SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021330 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021330
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 2 Region: 296-416
Classification Level Classification E-value
Superfamily TIMP-like 1.08e-35
Family Netrin-like domain (NTR/C345C module) 0.00022
Further Details:      
 
Domain Number 3 Region: 154-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021330   Gene: ENSBTAG00000016026   Transcript: ENSBTAT00000021330
Sequence length 416
Comment pep:known chromosome:UMD3.1:1:127132777:127229651:1 gene:ENSBTAG00000016026 transcript:ENSBTAT00000021330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGAWAPLCLLLVAAAQHSRPQLSERPVFTCGGILTGESGFIGSEGFPGVYPPNSKCT
WKITVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGALVSSSN
KMMVQMISDANTAGNGFMAMFSAAEPNERGDQYCGGLLERPSGSFKTPNWPDRDYPAGVT
CVWHIVAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEINDAERIGKYCGDSPPAPIV
SERNELLIQFLSDLSLTADGFIGHYKFRPKKLPTTTALPVTTTFPVSTTSLKPTVALCQQ
KCRRSGTLESNYCSSNFVLAGTVITTIPRGGSLHATVSIINIYKEGNLAIQQAGKNMSAK
VLVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLDALKNKQC
Download sequence
Identical sequences F1MKP1
ENSBTAP00000021330 9913.ENSBTAP00000021330 XP_010856445.1.44457 ENSBTAP00000021330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]