SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021383 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021383
Domain Number 1 Region: 399-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000377
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 285-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000832
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 4-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000449
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 4 Region: 255-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000755
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021383   Gene: ENSBTAG00000016063   Transcript: ENSBTAT00000021383
Sequence length 643
Comment pep:known_by_projection chromosome:UMD3.1:2:118194131:118436930:-1 gene:ENSBTAG00000016063 transcript:ENSBTAT00000021383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLVADPCTSNPCHHGNCSSSSSDGYLCICNEGYEGPNCEQALSSVPASGWTESTAPRQLQ
PVPATQEPEIMLPRSQATITLPTWQPKTGQKVVEMKWDQVEVVPDIACGNASANSSAGGR
LVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTLLQAPGGLVLLEEML
ALGQNHFIGFVNDSITKSIVALRLTLVVKTSTCVPGESRANDLECSGRGRCSTKPSEATF
SCNCDDQYTGTFCEEFDACQKKPCQNNASCVDAKEKQDGGNFTCVCLAGYTGELCQSKID
YCILDPCRNGATCTSNLSGFTCQCLEGYLGSTCEEKVDPCASAPCQNNGTCYADGLHFGC
SCSAGFTGPACAQLVDFCALSPCAHGTCRSVGTSYKCLCDPGYHGLYCEEEYDECVSAPC
LNAATCRDLVNGYECVCLAEYKGIHCESYKDPCANVSCLNGGTCDSEGLNGTCVCTPGFT
GEECDIDINECDSNPCHHAGTCLDQPNGYTCHCPHGWVGANCEIHLQWKSGHMAESLTNM
PRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSARPAYEDFYNCRSIDSEFSNAI
ASIRHARFGKKSRPAMYDVTPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences F1N5P0
ENSBTAP00000021383 ENSBTAP00000021383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]