SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021390 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021390
Domain Number 1 Region: 214-444
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 9.81e-17
Family Soluble quinoprotein glucose dehydrogenase 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000021390
Domain Number - Region: 638-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021390   Gene: ENSBTAG00000016071   Transcript: ENSBTAT00000021390
Sequence length 700
Comment pep:known chromosome:UMD3.1:17:13627444:13736747:-1 gene:ENSBTAG00000016071 transcript:ENSBTAT00000021390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGVRRRRCLNGNPPKRLKKKDRRMMSQPE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLDSKIFSVTNNTECGKLLEEIKCAVCSPHSQ
SLFYSPEREALERDLVLPLLCKDYCTEFFYTCRGHIPGLLQTTADEFCFYYARKDGGLCF
PDFPRKQIRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVSALQSGDGSH
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAMGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCHAPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNSSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVSKQWQEKPLCLGNG
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIIDPKRPLMPEECRAVVQP
AQTLTSECSRLCRNGYCTPTGTCCCSPGWEGDFCRIAKCEPACCHGGVCVRPNKCLCKKG
YLGAQCEQVDRNLRRVTRAGILDQIIDMTSYLLDLTSYIV
Download sequence
Identical sequences A5PJW9
NP_001092584.1.59421 NP_001092584.1.76553 ENSBTAP00000021390 ENSBTAP00000021390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]