SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021448 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021448
Domain Number 1 Region: 59-117
Classification Level Classification E-value
Superfamily Kringle-like 1.37e-19
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 2 Region: 178-223
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-16
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 3 Region: 28-71
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000685
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 4 Region: 118-169
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000742
Family Fibronectin type II module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021448   Gene: ENSBTAG00000016113   Transcript: ENSBTAT00000021448
Sequence length 223
Comment pep:known_by_projection chromosome:UMD3.1:18:55278948:55287983:1 gene:ENSBTAG00000016113 transcript:ENSBTAT00000021448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGWPSYLLGWMAFLLYSYGTTGNKKDSCIFPFTYKGSTYFSCTRANSLSPWCSTRAIYD
GRWKHCLTEDYPRCVFPFIYRGKPHNGCITDGSLFGRQWCSVTSSFDEKQQWKYCETNEY
GGNSFSKPCIFPATYRNHVVSECLEDENNKLWCPTTENMDKDGKWSLCADTRISSLVPGF
PCHFPFNYKNKNYFNCTNKGSKENLLWCATSYNYDRDHTWVYC
Download sequence
Identical sequences E1B9P4
9913.ENSBTAP00000021448 NP_001179487.1.59421 NP_001179487.1.76553 XP_015313653.1.76553 ENSBTAP00000021448 ENSBTAP00000021448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]