SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021471 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021471
Domain Number 1 Region: 34-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.32e-48
Family Ribosomal protein S7 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021471   Gene: ENSBTAG00000016133   Transcript: ENSBTAT00000021471
Sequence length 242
Comment pep:known chromosome:UMD3.1:19:56859683:56862920:-1 gene:ENSBTAG00000016133 transcript:ENSBTAT00000021471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPTAKVSRGWSGLALGVRIAVLRLPGLTQVRWSRYGPEYQDPQIDKEYYRKPLAQLTE
EETYERELRKTQVIKAAPATKTSSVFEDPVISKFTNMMMKGGNKILARSLMTQTLEAVKR
KQFEKYHAASAEEQATVERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLAERRRR
FLAMKWMITECREKKPRRMLMPEKLSQELLEAFCNRGPVIKRKHDMHKMAEANRALAHYR
WW
Download sequence
Identical sequences Q3T040
NP_001029515.1.59421 NP_001029515.1.76553 3jd5_G ENSBTAP00000021471 ENSBTAP00000021471 9913.ENSBTAP00000021471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]