SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021495 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021495
Domain Number 1 Region: 70-117,510-545
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000091
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021495   Gene: ENSBTAG00000016149   Transcript: ENSBTAT00000021495
Sequence length 548
Comment pep:known chromosome:UMD3.1:20:35092195:35158959:1 gene:ENSBTAG00000016149 transcript:ENSBTAT00000021495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGQRFAFAICILEISLLRAGPTPSYDPAERQGTPLPIDCRMSSWSEWSKCDPCLKQMF
RSRSIEIFGQFNGRKCVDAVGDRQQCVPTEACEDPEEGCGNDFQCGTGRCIKNRLLCNED
NDCGDYSDEDNCEQDPRPPCRNRVVEESELARTAGFGINILGMDPLSTPFDNQYYNGLCD
RVWDGNTLTYYRRPWNVASLTYDTKADKNFRTENHEESIQILRTIIEEKKLNFNAGLSVK
YTPVEAIEKNKCVDLEHSDKGSTSSPSKLAAEAKFRFTYSKDDIYRLLSSYSAKQEKMFL
HVKGKVHLGRFVMRSRDVMLQTTFLDSINTLPTTYEKGEYFAFLETYGTHYSSSGSLGGL
YELIYVLDKKSMEQKDIELRDVQRCLGFDLDLSLKVGVEVTGNFDSKLCSKKGMGQTETN
PEADLFDDVITFIRGGTRKYATELKEKLLRGARMINVTDFVNWAASLNHAPVLISQKLVP
IYDLIPVKMKDAHLKKQNLERAIEDYINEFSVRKCQPCQNGGTVVLLDGECVCSCPKEFK
GVACEIKK
Download sequence
Identical sequences Q3MHN2
ENSBTAP00000021495 ENSBTAP00000021495 9913.ENSBTAP00000021495 NP_001030441.1.59421 NP_001030441.1.76553 XP_015314577.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]