SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021517 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021517
Domain Number 1 Region: 92-396
Classification Level Classification E-value
Superfamily L domain-like 3.57e-56
Family Leucine rich effector protein YopM 0.053
Further Details:      
 
Domain Number 2 Region: 489-629
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.74e-36
Family Gelsolin-like 0.00024
Further Details:      
 
Domain Number 3 Region: 1153-1264
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.2e-25
Family Gelsolin-like 0.00082
Further Details:      
 
Domain Number 4 Region: 609-720
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.82e-25
Family Gelsolin-like 0.00057
Further Details:      
 
Domain Number 5 Region: 884-943,977-1057
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.19e-23
Family Gelsolin-like 0.011
Further Details:      
 
Domain Number 6 Region: 701-848
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.47e-20
Family Gelsolin-like 0.0027
Further Details:      
 
Domain Number 7 Region: 24-120
Classification Level Classification E-value
Superfamily L domain-like 1.76e-16
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.048
Further Details:      
 
Domain Number 8 Region: 1051-1143
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000935
Family Gelsolin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021517   Gene: ENSBTAG00000016161   Transcript: ENSBTAT00000021517
Sequence length 1268
Comment pep:known_by_projection chromosome:UMD3.1:19:34989027:35000650:1 gene:ENSBTAG00000016161 transcript:ENSBTAT00000021517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCATPLKPLEAGISCGGRVGQGGYFPENVKAMTSLRWLKLNRTGLCYLPEELASLQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSYNQLTECP
RELENAKNMLVLNLSHNSIDSIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LNGNPLLHAQLRQLPALTALQTLHLRNTQRTQSNLPTSLEGLSHLADVDLSCNDLTRVPE
CLYALPGLRRLNLSSNQIAELSLCIDQWVHLETLNLSRNQLTSLPSAICKLTKLKRLYLN
SNQLDFDGLPSGIGKLSSLEEFMAANNKLELIPESLCRCTKLRKLVLNKNRLVTLPEAIH
FLTEIEVLDVRENPSLVMPPKPVDRAAEWYNIDFSLQNQLRLAGASPATVAAAAAAGSGP
KDPLARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNRKQEESAEAGAPGGKVRRWDQGL
EKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEDLHGKFYEADCYIVLKTFLDDSGS
LNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISY
IEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGASLDPRFVFLLDRGLDIYVWR
GAQATLSSTTKARLFAEKINKNERKGKAEISLLVQGQEPPEFWETLGGEPSEIKKHVPDD
FWPPQPKLYKVGLGLGYLELPQINYKLSVEHKKRPKVELMPRMRLLQSLLDTRCVYILDC
WSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHAMVSRSLEGTEAQVFKAKFKNWDD
VLSVDYTRNAEAMLQGPGLAGKVKRDAEKKDQMKADLTALFLPRQPPMALAEAEQLMEEW
NEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKEEEKAGAED
KEGKEAAAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPGKLEVVRM
TQQQENPKFLSHFKRKFIIHRGKRKAAQGALQPSLYQIRTNGSALCTRCIQINTDSSLLN
SEFCFILKVPFESEDNQGIVYAWVGRASDPDEAKLAEDILNSMFEASYSKQVINEGEEPE
NFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDNG
QEVYMWVGSQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHAW
STFRQALA
Download sequence
Identical sequences F1N365
9913.ENSBTAP00000021517 ENSBTAP00000021517 ENSBTAP00000021517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]