SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021634 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021634
Domain Number 1 Region: 224-351
Classification Level Classification E-value
Superfamily TPR-like 8.54e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 2 Region: 94-221
Classification Level Classification E-value
Superfamily FKBP-like 1.18e-22
Family FKBP immunophilin/proline isomerase 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021634   Gene: ENSBTAG00000016264   Transcript: ENSBTAT00000021634
Sequence length 411
Comment pep:known chromosome:UMD3.1:7:4566171:4574944:1 gene:ENSBTAG00000016264 transcript:ENSBTAT00000021634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCAEPSAADPEPTAPPPAGVPPLEDFEVLDGVEDAEGEEEEEEDLSELPPLEDVGQPP
LEEAEQPGALAREFLAAMEPEPEPAPAPDEWLDILGNGLLRKKTLVPGPPGSSRPTKGQV
VTVRLQTSLENGTRVQEEPDLVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQ
GSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAA
NSYDLAIKAITSSAKVDMTFEEEEQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEH
QPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTET
ALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Download sequence
Identical sequences F1N2P6
ENSBTAP00000021634 9913.ENSBTAP00000021634 ENSBTAP00000021634 NP_001192650.1.59421 NP_001192650.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]