SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021676 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021676
Domain Number 1 Region: 278-448
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-42
Family SPRY domain 0.0000873
Further Details:      
 
Domain Number 2 Region: 8-73
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000132
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 3 Region: 87-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000168
Family B-box zinc-binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021676   Gene: ENSBTAG00000016293   Transcript: ENSBTAT00000021676
Sequence length 450
Comment pep:known chromosome:UMD3.1:29:5175376:5195893:1 gene:ENSBTAG00000016293 transcript:ENSBTAT00000021676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASAQCLPTEIICSICKDTFTDPATIRCGHRFCTPCLCLLWEDAPTVTCCPVCKAASP
KMDLKSTILAKKHIRSTGNSVICQLPGSAKQMCRTHQVIKLYFCEADKSLLCLFCSRSTG
HATHEHYSVVQVAEHYREHLLMQMKSIWKKKQENQRNIKKVTNTFRAWEGFINLRLVMIR
AEYPKVCQYLQEEKQKHLEMLAIEGTVIFQRLNRNVARMIHMGKLLRKTYEELKEMCLKA
DVDMLQGVEDTMKRSQLMQLYIPQPLDPQLSTWTITGMLERLNSFRVYITLDGKIRNGCV
PLIEALRRLQCGPVDRDVPWDAACPENTPTWGAQTFTAGKHYWEVDVGNSGDWVIGLCKE
SWTSRNDMLLNSEDIFLLLCVSKDGHFSLFSTFPFLPHYIQRPQGYIGVFLDYECGMISF
INVARGSLICNFLSRSFSFPLRPFIWCGPK
Download sequence
Identical sequences A9Q1J6
NP_001104732.1.59421 NP_001104732.1.76553 XP_010819096.1.76553 ENSBTAP00000021676 ENSBTAP00000021676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]