SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021701 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021701
Domain Number 1 Region: 195-332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.02e-48
Family Galectin (animal S-lectin) 0.00025
Further Details:      
 
Domain Number 2 Region: 11-153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.76e-46
Family Galectin (animal S-lectin) 0.0000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021701   Gene: ENSBTAG00000016312   Transcript: ENSBTAT00000021701
Sequence length 332
Comment pep:known_by_projection chromosome:UMD3.1:18:48803147:48810095:-1 gene:ENSBTAG00000016312 transcript:ENSBTAT00000021701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVPAPGYQPTYNPTLPYHNPIPGGLRVGMSVYIQGVASEHMKRFFVNFEVGQGQGADV
AFHFNPRFDGWDKVVLNSKQNGSWGQEERKMSMPFRKGAAFELVFMVMTEHFKVVVNGTP
FYEFKHRILLQMVTHLHVDGDLMLQSINFIGGQPPSNQMPMPAQAYPMPMSAQAYPSPGQ
YYQQQSRLPTMEGPPAFNPPVPFNGRLQGGLIVRRTIIIKGYIPPTAKSFVINFKVGSSG
DVALHINPRMTEGAVVRNSFLNGSWGSEERKVSYNPFGPGQFFDLSVRCGADRFKVYANG
KHLFDFSHRLSAFQRVDLVEIHGDVTLSYVQI
Download sequence
Identical sequences G5E5J2
ENSBTAP00000021701 ENSBTAP00000021701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]