SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021782 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021782
Domain Number 1 Region: 190-302
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-16
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 2 Region: 397-434
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 138-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000089
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 33-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000183
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 5 Region: 328-352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000956
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000021782
Domain Number - Region: 354-396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0034
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021782   Gene: ENSBTAG00000016378   Transcript: ENSBTAT00000021782
Sequence length 712
Comment pep:known chromosome:UMD3.1:10:21786857:21792534:-1 gene:ENSBTAG00000016378 transcript:ENSBTAT00000021782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAILLLFLGGTVAHPDRIIFPNPACEDPPAVLLEVQGTLQRPVGRDSRSSPANCTWLI
LGRKEQTVTVRFQKLHLACGSERLTLRSPIQPQISLCEAPASPLQLPGGNVTITYSYVGA
RAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVPLLQRCDGVDACGDGSDEAGCSSDPFPD
LALAPVLTPPCNHTLEDFYGVFSSFGYSHLASVSHPQSCRWLLDPRDGRRLAVRFTALDL
GYDDAVRVYDGAGPLETLRLLRSLTRFSNGKAVTVETLSGQATVDYRTVPWSTGRGFNAT
YHVRGYCLPWDRPCGLSSGLGASEGLGERCYSEAQRCDGSWDCADGTDEENCPSCPPGHY
PCGAAGTPGATACYLPTDRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQ
PDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPLS
RMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGST
SGARRRQRGRSMRRLVRRLRRWGLLPRTNPPARTPETRSQATPSTAPPETLDGSTGPAHE
GGAVGGQDGDQAPPLPVKAPLPPASTSPACPTVPEAPGPLPAVPLEPSLLSGVVQALRGR
LLPSLRPPGPTRASPGPHTTVLSPEDEDDVLLVPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences A6QPB1
ENSBTAP00000021782 ENSBTAP00000021782 NP_001093841.1.59421 NP_001093841.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]