SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021789 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021789
Domain Number 1 Region: 229-466
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.27e-82
Family Eukaryotic proteases 0.00000000602
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 1.85e-25
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 127-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.00021
Further Details:      
 
Domain Number 4 Region: 93-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family EGF-type module 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021789   Gene: ENSBTAG00000016385   Transcript: ENSBTAT00000021789
Sequence length 492
Comment pep:known chromosome:UMD3.1:12:90516721:90530178:1 gene:ENSBTAG00000016385 transcript:ENSBTAT00000021789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLLHLVLLSTALGGLLRPAGSVFLPRDQAHRVLQRARRANSFLEEVKQGNLERECLEE
ACSLEEAREVFEDAEQTDEFWSKYKDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKN
CEFSTREICSLDNGGCDQFCREERSEVRCSCAHGYVLGDDSKSCVSTERFPCGKFTQGRS
RRWAIHTSEDALDASELEHYDPADLSPTESSLDLLGLNRTEPSAGEDGSQVVRIVGGRDC
AEGECPWQALLVNEENEGFCGGTILNEFYVLTAAHCLHQAKRFTVRVGDRNTEQEEGNEM
AHEVEMTVKHSRFVKETYDFDIAVLRLKTPIRFRRNVAPACLPEKDWAEATLMTQKTGIV
SGFGRTHEKGRLSSTLKMLEVPYVDRSTCKLSSSFTITPNMFCAGYDTQPEDACQGDSGG
PHVTRFKDTYFVTGIVSWGEGCARKGKFGVYTKVSNFLKWIDKIMKARAGAAGSRGHSEA
PATWTVPPPLPL
Download sequence
Identical sequences P00743
ENSBTAP00000021789 NP_001073682.1.59421 NP_001073682.1.76553 ENSBTAP00000021789 9913.ENSBTAP00000021789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]