SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000021903 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000021903
Domain Number 1 Region: 50-383
Classification Level Classification E-value
Superfamily L domain-like 1.81e-59
Family Ngr ectodomain-like 0.0046
Further Details:      
 
Domain Number 2 Region: 424-522
Classification Level Classification E-value
Superfamily Immunoglobulin 3.31e-20
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000021903   Gene: ENSBTAG00000016478   Transcript: ENSBTAT00000021903
Sequence length 613
Comment pep:known_by_projection chromosome:UMD3.1:7:22560008:22561849:1 gene:ENSBTAG00000016478 transcript:ENSBTAT00000021903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPAHRCPRGWWRGPRPRLRTMTCWLWVLSLQFLLLPAALPPAGGCPARCECTAQTRAVA
CPRRRLTAVPDGIPAETRLLELSRNRIRCLNPGDLAALPLLEELDLSENVIAHVEPGAFA
NLPRLRVLRLRGNLLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLRSLRRLEVGD
NDLVFISRRAFAGLLALEELTLERCNLTALSGESLGHLRGLGALRLRHLAIAALEDQNFQ
RLPGLLHLEIDNWPLLEEVAAGSLRGLNLTSLSVTHTNITAVPSAALRHQAHLTCLNLSH
NPISTVPRGSFRDLVRLRELHLAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFH
SVNTLETLRVDGNPLACDCRLLWVVQRRKTLNFDGRPPACATPAEVRGDALRSLPDSALF
EYFVCRKPKIRERRLQRITAAAGADVRFQCRAEGEPAPTVAWVTPRHRTVTAASAGRARV
LPGGTLHIQDARPGDSGTYTCVASNAGGNDTYFATLSVQPEPAVNRTPGEGRNDTQVAAR
FPLDLTTILVSTAMGCITFLGVVLFCFLLLFVWSRGRGQHKNNFSVEYSFRKVDGPAAAA
GQGGARKFNMKMI
Download sequence
Identical sequences F1N3H2
ENSBTAP00000021903 ENSBTAP00000021903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]