SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022005 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022005
Domain Number 1 Region: 250-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000119
Family Laminin-type module 0.045
Further Details:      
 
Domain Number 2 Region: 379-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 3 Region: 431-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 4 Region: 316-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 534-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022005   Gene: ENSBTAG00000016542   Transcript: ENSBTAT00000022005
Sequence length 1172
Comment pep:known_by_projection chromosome:UMD3.1:16:75567714:75610920:1 gene:ENSBTAG00000016542 transcript:ENSBTAT00000022005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLLLLYFGLPSLLCAQQACSRGACYPPVGDLLIGRTRFLRASSTCGLTKPETYCAQYG
EWQMKCCKCDSRVAHNYNSHQVENVVSSSGPTRWWQSQNDVSPVFLQLDLDRKFQLQDIM
MDFKGPVPAGLLIERSSDFGKTWQVYQYLAADCGSAFPWVRQGQPQGWQDARCQTLPQRP
NGHPNGAKVQLNLMDLASGIPATQSQKIQELGEITNLRVNFTKLAPVPQRGYHPPSAYYA
VSQLRLHGSCLCHGHADRCAPSSRTPASPSSAVQVHEVCVCQHNTAGPNCERCAPFYNNR
PWRPAEDQDPHECQRCDCNGHSETCHFDPAVFAASQGAHGGVCDNCRDHTEGRNCERCQL
HYFRNRRPGAPIQETCIPCECDPDGAVPGAPCDPLTGQCVCKEHVQGERCDLCKPGFTGL
TFSNPQGCHRCDCSVLGARRDVPCDEETGRCVCLPHVVGPKCDQCAPHHWKLASGRGCEP
CACDPHNSLGPQCNQFTGQCACREGFGGLTCRAAAIRQCPDRTYGDAAAGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCDRAPVCVACHPCFQTYDGGLRERALRLA
GLRNASAALWPQPGLEDHGLASRMLDAKSKMEQIQATLGDALVTEEEVAQVANAIFSIRR
TLQGLQLDLPLEEETLSLPGDLGSLDRSFNRLLVTYQSKREQFEKISSADPSGAFRMLTA
AHQRSSQAAQQVSDSSRRLLQLRDSRREAERLEQQVAGGPGASGPQLAALRLEMASVPDL
TPTINQLCGGSREMPCTPGACPGELCPRDNRTACGSRCRGALPRAGGALRTAGQVAEQLR
AFSTQLQQTRQMIRAAEEAASQVQSDTQRLETQVSASRSQMEEDVRRTRLLIQQVREFLS
DPDTDTATIQEVSEAVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDVARAR
RLQAEAEQARSRAHAVEGQVEEVLGALRQGTLALQEAQDTMRGTRRSMRLIQDRVAEVQQ
VLGPAERLVTSMTQQLGGFRARMEELGRRARQQQAQAAQARQLAEEASKEALNAQEGFER
VKQKYAELKDRLDQSSMLGEQGSRILSVKTEAEELFGETMEMMDRMRDMESELLQGSQAI
VLRSADLTGLEQRVEQIRNHINGRVLYYATCK
Download sequence
Identical sequences F1MMK1
ENSBTAP00000022005 ENSBTAP00000022005 XP_005217424.1.76553 XP_010811866.1.76553 XP_010811867.1.76553 XP_015330760.1.76553 XP_015330761.1.76553 XP_015330762.1.76553 XP_015330763.1.76553 XP_015330764.1.76553 XP_015330765.1.76553 XP_015330766.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]