SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000022024 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000022024
Domain Number 1 Region: 92-284
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-51
Family SPRY domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000022024
Domain Number - Region: 273-310
Classification Level Classification E-value
Superfamily SOCS box-like 0.0011
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000022024   Gene: ENSBTAG00000016558   Transcript: ENSBTAT00000022024
Sequence length 345
Comment pep:known chromosome:UMD3.1:25:1354553:1360122:-1 gene:ENSBTAG00000016558 transcript:ENSBTAT00000022024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRPRSSRAWHFVLSAARRDADARAVALAGTANWGYDSDGQHSDSDSDPECASLPSSIP
SAVPVTGESFCDCDSQSEAFCGSLHTAHRGRDCRCGEEDEYFDWVWDDLNKSSATLLSCD
NRKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHT
FCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIG
VAATQLQNKRFYPMVCSTAAKSSMKVIRSCASVTSLQYLCCFRLRQLRPGSGDTLEGLPL
PPGLKQVLHHKLGWVLSMSRQPPAPSPAANGPEPRRCQRKRCRRT
Download sequence
Identical sequences M5FHR0 Q3MHZ2
ENSBTAP00000022024 ENSBTAP00000022024 NP_001029678.1.59421 NP_001029678.1.76553 XP_005224505.1.76553 XP_005886879.1.15283 XP_010817394.1.76553 XP_019842803.1.53367 XP_019842804.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]